TTF1 Rabbit mAb (A22248)

TTF1 Rabbit mAb (A22248)

TTF1 Rabbit mAb (A22248)

$148.00$548.00

In stock

$148.00$548.00

Abclonal TTF1 Rabbit mAb (Catalog Number: A22248) encodes a protein initially identified as a thyroid-specific transcription factor.

Store
SKU: A22248 Categories: ,
Clear
View cart
Order Offline:
Phone: 1-617-401-8149
Fax: 1-617-606-5019
Email: message@sydlabs.com
Catalog No. A22248
Product NameTTF1 Rabbit mAb (A22248)
Supplier Name ABclonal, Inc.
Brand Name Abclonal
Synonyms BCH; BHC; NK-2; TEBP; TTF1; NKX2A; NMTC1; T/EBP; TITF1; TTF-1; NKX2.1
Gene Name NKX2-1
Protein Name NKX2-1
Uniprot/Swissprot ID P43699
Gene ID 7080
Clone ARC2744
Clonality Monoclonal
Source/Host Rabbit
Reactivity Human, Mouse, Rat
Conjugate Unconjugated
Note Products will be shipped from the warehouse in Massachusetts. Promotion is running from time to time. Welcome to send a request for quote to message@sydlabs.com.
Order Offline Syd Labs, Inc. 4 Avenue E, Hopkinton, MA 01748 USA. Phone: 1-617-401-8149 Fax: 1-617-606-5019 Email: message@sydlabs.com

Description

A22248: TTF1 Rabbit mAb

This gene encodes a protein initially identified as a thyroid-specific transcription factor. The encoded protein binds to the thyroglobulin promoter and regulates the expression of thyroid-specific genes but has also been shown to regulate the expression of genes involved in morphogenesis. Mutations and deletions in this gene are associated with benign hereditary chorea, choreoathetosis, congenital hypothyroidism, and neonatal respiratory distress, and may be associated with thyroid cancer. Multiple transcript variants encoding different isoforms have been found for this gene. This gene shares the symbol/alias ‘TTF1’ with another gene, transcription termination factor 1, which plays a role in ribosomal gene transcription.

Immunogen Information about TTF1 Rabbit mAb (A22248)

Immunogen:Recombinant protein of human NKX2-1
Sequence:MSMSPKHTTPFSVSDILSPLEESYKKVGMEGGGLGAPLAAYRQGQAAPPTAAMQQHAVGHHGAVTAAYHMTAAGVPQLSHSAVGGYCNGNLGNMSELPPY
Gene ID:7080
Swiss prot:P43699
Synonyms:BCH; BHC; NK-2; TEBP; TTF1; NKX2A; NMTC1; T/EBP; TITF1; TTF-1; NKX2.1
Calculated MW:39kDa
Observed MW:Refer to figures

Images of TTF1 Rabbit mAb (A22248)

Immunohistochemistry analysis of paraffin-embedded Human lung adenocarcinoma using NKX2-1 Rabbit mAb (A22248) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

Immunohistochemistry analysis of paraffin-embedded human thyroid cancer using NKX2-1 Rabbit mAb (A22248) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

Immunohistochemistry analysis of paraffin-embedded human thyroid using NKX2-1 Rabbit mAb (A22248) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

Immunohistochemistry analysis of paraffin-embedded mouse lung using NKX2-1 Rabbit mAb (A22248) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

Please remember our product information: TTF1 Rabbit mAb (Catalog Number: A22248) Abclonal

No more offers for this product!