[KO Validated] SMARCB1/SNF5 Rabbit mAb (A3247)

Catalog No.	A3247
Product Name	[KO Validated] SMARCB1/SNF5 Rabbit mAb (A3247)
Supplier Name	ABclonal, Inc.
Brand Name	Abclonal
Synonyms	RDT; CSS3; INI1; SNF5; Snr1; BAF47; INI-1; MRD15; RTPS1; Sfh1p; hSNFS; SNF5L1; SWNTS1; PPP1R144
Gene Name	SMARCB1
Protein Name	SMARCB1
Uniprot/Swissprot ID	Q12824
Entrez GeneID	6598
Clone	ARC53139
Clonality	Monoclonal
Source/Host	Rabbit
Applications	WB, IHC-P
Reactivity	Human, Mouse, Rat
Conjugate	Unconjugated
Note	Products will be shipped from the warehouse in Massachusetts. Promotion is running from time to time. Welcome to send a request for quote to message@sydlabs.com.
Order Offline	Syd Labs, Inc. 4 Avenue E, Hopkinton, MA 01748 USA. Phone: 1-617-401-8149 Fax: 1-617-606-5019 Email: message@sydlabs.com

Description

A3247: [KO Validated] SMARCB1/SNF5 Rabbit mAb

The protein encoded by this gene is part of a complex that relieves repressive chromatin structures, allowing the transcriptional machinery to access its targets more effectively. The encoded nuclear protein may also bind to and enhance the DNA joining activity of HIV-1 integrase. This gene has been found to be a tumor suppressor, and mutations in it have been associated with malignant rhabdoid tumors. Alternatively spliced transcript variants have been found for this gene.

Immunogen Information about [KO Validated] SMARCB1/SNF5 Rabbit mAb (A3247)

Immunogen：A synthetic peptide corresponding to a sequence within amino acids 50-150 of human SMARCB1/SNF5 (NP_003064.2).
Sequence：LWRRLATVEERKKIVASSHGKKTKPNTKDHGYTTLATSVTLLKASEVEEILDGNDEKYKAVSISTEPPTYLREQKAKRNSQWVPTLPNSSHHLDAVPCSTT
Gene ID：6598
Swiss prot：Q12824
Synonyms：RDT; CSS3; INI1; SNF5; Snr1; BAF47; INI-1; MRD15; RTPS1; Sfh1p; hSNFS; SNF5L1; SWNTS1; PPP1R144; F5
Calculated MW：44kDa
Observed MW：44kDa

Images of [KO Validated] SMARCB1/SNF5 Rabbit mAb (A3247)

Western blot analysis of various lysates, using SMARCB1/SNF5 Rabbit mAb (A3247) at 1:10000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:2000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.

Western blot analysis of lysates from wild type(WT) and SMARCB1/SNF5 Rabbit mAb knockout (KO) HeLa(KO) cells, using SMARCB1/SNF5 Rabbit mAb (A3247) at 1:2000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.

Immunohistochemistry analysis of SMARCB1/SNF5 in paraffin-embedded Human epithelioid sarcoma (ini-1 deletion) using [KO Validated] SMARCB1/SNF5 Rabbit mAb (A3247) at dilution of 1:100(40x lens).Perform high pressure antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.

Immunohistochemistry analysis of SMARCB1/SNF5 in paraffin-embedded Human colon carcinoma using [KO Validated] SMARCB1/SNF5 Rabbit mAb (A3247) at dilution of 1:100(40x lens).Perform high pressure antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.

Immunohistochemistry analysis of SMARCB1/SNF5 in paraffin-embedded Rat lung using [KO Validated] SMARCB1/SNF5 Rabbit mAb (A3247) at dilution of 1:100(40x lens).Perform high pressure antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.

Immunohistochemistry analysis of SMARCB1/SNF5 in paraffin-embedded Mouse heart using [KO Validated] SMARCB1/SNF5 Rabbit mAb (A3247) at dilution of 1:100(40x lens).Perform high pressure antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.

Immunohistochemistry analysis of SMARCB1/SNF5 in paraffin-embedded Human undifferentiated carcinoma of esophagus using [KO Validated] SMARCB1/SNF5 Rabbit mAb (A3247) at dilution of 1:100(40x lens).Perform high pressure antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.

Please remember our product information: [KO Validated] SMARCB1/SNF5 Rabbit mAb (Catalog Number: A3247) Abclonal

Additional information

Ship from Country	USA
Size	20 ul, 100 ul, 200 ul, 50 ul

No more offers for this product!