[KO Validated] MSH6 Rabbit mAb (A22652)

[KO Validated] MSH6 Rabbit mAb (A22652)

[KO Validated] MSH6 Rabbit mAb (A22652)

$148.00$548.00

In stock

$148.00$548.00

Abclonal [KO Validated] MSH6 Rabbit mAb (Catalog Number: A22652) encodes a member of the DNA mismatch repair MutS family. In E. coli, the MutS protein helps in the recognition of mismatched nucleotides prior to their repair.

Store
SKU: A22652 Categories: ,
Clear
View cart
Order Offline:
Phone: 1-617-401-8149
Fax: 1-617-606-5019
Email: message@sydlabs.com
Catalog No. A22652
Product Name[KO Validated] MSH6 Rabbit mAb (A22652)
Supplier Name ABclonal, Inc.
Brand Name Abclonal
Synonyms GTBP; HSAP; p160; GTMBP; MSH-6; HNPCC5; LYNCH5; MMRCS3
Gene Name MSH6
Protein Name MSH6
Uniprot/Swissprot ID P52701
Gene ID 2956
Clone ARC57727
Clonality Monoclonal
Source/Host Rabbit
Reactivity Human,Mouse,Rat
Conjugate Unconjugated
Note Products will be shipped from the warehouse in Massachusetts. Promotion is running from time to time. Welcome to send a request for quote to message@sydlabs.com.
Order Offline Syd Labs, Inc. 4 Avenue E, Hopkinton, MA 01748 USA. Phone: 1-617-401-8149 Fax: 1-617-606-5019 Email: message@sydlabs.com

Description

A22652: [KO Validated] MSH6 Rabbit mAb

This gene encodes a member of the DNA mismatch repair MutS family. In E. coli, the MutS protein helps in the recognition of mismatched nucleotides prior to their repair. A highly conserved region of approximately 150 aa, called the Walker-A adenine nucleotide binding motif, exists in MutS homologs. The encoded protein heterodimerizes with MSH2 to form a mismatch recognition complex that functions as a bidirectional molecular switch that exchanges ADP and ATP as DNA mismatches are bound and dissociated. Mutations in this gene may be associated with hereditary nonpolyposis colon cancer, colorectal cancer, and endometrial cancer. Transcripts variants encoding different isoforms have been described.

Immunogen Information about [KO Validated] MSH6 Rabbit mAb (A22652)

Immunogen:A synthetic peptide corresponding to a sequence within amino acids 1-100 of human MSH6 (NP_000170.1).
Sequence:MSRQSTLYSFFPKSPALSDANKASARASREGGRAAAAPGASPSPGGDAAWSEAGPGPRPLARSASPPKAKNLNGGLRRSVAPAAPTSCDFSPGDLVWAKM
Gene ID:2956
Swiss prot:P52701
Synonyms:GTBP; HSAP; p160; GTMBP; MSH-6; HNPCC5; LYNCH5; MMRCS3; H6
Calculated MW:153kDa
Observed MW:180kDa

Images of [KO Validated] MSH6 Rabbit mAb (A22652)

Western blot analysis of various lysates, using MSH6 antibody (A22652) at 1:3000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 3s.

Western blot analysis of Rat testis, using MSH6 antibody (A22652) at 1:3000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 3s.

Western blot analysis of extracts from wild type(WT) and MSH6 knockout (KO) 293T cells, using MSH6 antibody (A22652) at 1:3000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 3s.

Immunohistochemistry analysis of paraffin-embedded human colon carcinoma using [KO Validated] MSH6 Rabbit mAb (A22652) at dilution of 1:400 (40x lens).Perform high pressure antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.

Immunofluorescence analysis of NIH/3T3 using MSH6 Rabbit mAb (A22652) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

Please remember our product information: [KO Validated] MSH6 Rabbit mAb (Catalog Number: A22652) Abclonal

No more offers for this product!