[KO Validated] MSH2 Rabbit mAb (A22177)
$148.00 – $548.00
Abclonal [KO Validated] MSH2 Rabbit mAb (Catalog Number: A22177) This locus is frequently mutated in hereditary nonpolyposis colon cancer (HNPCC). When cloned, it was discovered to be a human homolog of the E.
- Details & Specifications
- References
| Catalog No. | A22177 |
|---|---|
| Product Name | [KO Validated] MSH2 Rabbit mAb (A22177) |
| Supplier Name | ABclonal, Inc. |
| Brand Name | Abclonal |
| Synonyms | FCC1; COCA1; HNPCC; LCFS2; MSH-2; hMSH2; HNPCC1; LYNCH1; MMRCS2 |
| Gene Name | MSH2 |
| Protein Name | MSH2 |
| Uniprot/Swissprot ID | P43246 |
| Gene ID | 4436 |
| Clone | ARC55799 |
| Clonality | Monoclonal |
| Source/Host | Rabbit |
| Reactivity | Human, Mouse, Rat |
| Conjugate | Unconjugated |
| Note | Products will be shipped from the warehouse in Massachusetts. Promotion is running from time to time. Welcome to send a request for quote to message@sydlabs.com. |
| Order Offline | Syd Labs, Inc. 4 Avenue E, Hopkinton, MA 01748 USA. Phone: 1-617-401-8149 Fax: 1-617-606-5019 Email: message@sydlabs.com |
Description
A22177: [KO Validated] MSH2 Rabbit mAb
This locus is frequently mutated in hereditary nonpolyposis colon cancer (HNPCC). When cloned, it was discovered to be a human homolog of the E. coli mismatch repair gene mutS, consistent with the characteristic alterations in microsatellite sequences (RER+ phenotype) found in HNPCC. Two transcript variants encoding different isoforms have been found for this gene.
Immunogen Information about [KO Validated] MSH2 Rabbit mAb (A22177)
Immunogen:Recombinant fusion protein containing a sequence corresponding to amino acids 330-583 of human MSH2 (NP_000242.1).
Sequence:LNKCKTPQGQRLVNQWIKQPLMDKNRIEERLNLVEAFVEDAELRQTLQEDLLRRFPDLNRLAKKFQRQAANLQDCYRLYQGINQLPNVIQALEKHEGKHQKLLLAVFVTPLTDLRSDFSKFQEMIETTLDMDQVENHEFLVKPSFDPNLSELREIMNDLEKKMQSTLISAARDLGLDPGKQIKLDSSAQFGYYFRVTCKEEKVLRNNKNFSTVDIQKNGVKFTNSKLTSLNEEYTKNKTEYEEAQDAIVKEIVN
Gene ID:4436
Swiss prot:P43246
Synonyms:FCC1; COCA1; HNPCC; LCFS2; MSH-2; hMSH2; HNPCC1; LYNCH1; MMRCS2; H2
Calculated MW:105kDa
Observed MW:105kDa
Images of [KO Validated] MSH2 Rabbit mAb (A22177)

Western blot analysis of extracts from wild type(WT) and MSH2 knockout (KO) HeLa cells, using MSH2 antibody (A22177) at1:20000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 60s.

Western blot analysis of various lysates, using MSH2 antibody (A22177) at1:20000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 60s.

Immunohistochemistry analysis of paraffin-embedded human colon carcinoma using [KO Validated] MSH2 Rabbit mAb (A22177) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.

Immunohistochemistry analysis of paraffin-embedded human tonsil using [KO Validated] MSH2 Rabbit mAb (A22177) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.
Please remember our product information: [KO Validated] MSH2 Rabbit mAb (Catalog Number: A22177) Abclonal
![A22177: [KO Validated] MSH2 Rabbit mAb](https://www.ushelf.com/wp-content/uploads/2023/10/A22177-2.jpg)
![[KO Validated] MSH2 Rabbit mAb (Catalog Number: A22177) Abclonal](https://www.ushelf.com/wp-content/uploads/2023/10/A22177-3.jpg)
![Abclonal [KO Validated] MSH2 Rabbit mAb (Catalog Number: A22177)](https://www.ushelf.com/wp-content/uploads/2023/10/A22177-4.jpg)
![[KO Validated] MSH2 Rabbit mAb (A22177)](https://www.ushelf.com/wp-content/uploads/2023/10/A22177-1-150x150.jpg)
![A22177: [KO Validated] MSH2 Rabbit mAb](https://www.ushelf.com/wp-content/uploads/2023/10/A22177-2-150x150.jpg)
![[KO Validated] MSH2 Rabbit mAb (Catalog Number: A22177) Abclonal](https://www.ushelf.com/wp-content/uploads/2023/10/A22177-3-150x150.jpg)
![Abclonal [KO Validated] MSH2 Rabbit mAb (Catalog Number: A22177)](https://www.ushelf.com/wp-content/uploads/2023/10/A22177-4-150x150.jpg)
