[KO Validated] MLH1 Rabbit mAb (A4858)
$148.00 – $548.00
Abclonal [KO Validated] MLH1 Rabbit mAb (Catalog Number: A4858) encoded by this gene can heterodimerize with mismatch repair endonuclease PMS2 to form MutL alpha, part of the DNA mismatch repair system.
- Details & Specifications
- References
- More Offers
Catalog No. | A4858 |
---|---|
Product Name | [KO Validated] MLH1 Rabbit mAb (A4858) |
Supplier Name | ABclonal, Inc. |
Brand Name | Abclonal |
Synonyms | FCC2; COCA2; HNPCC; MLH-1; hMLH1; HNPCC2; LYNCH2; MMRCS1 |
Gene Name | MLH1 |
Protein Name | MLH1 |
Uniprot/Swissprot ID | P40692 |
Gene ID | 4292 |
Clone | ARC53543 |
Clonality | Monoclonal |
Source/Host | Rabbit |
Reactivity | Human, Mouse |
Conjugate | Unconjugated |
Note | Products will be shipped from the warehouse in Massachusetts. Promotion is running from time to time. Welcome to send a request for quote to message@sydlabs.com. |
Order Offline | Syd Labs, Inc. 4 Avenue E, Hopkinton, MA 01748 USA. Phone: 1-617-401-8149 Fax: 1-617-606-5019 Email: message@sydlabs.com |
Description
A4858: [KO Validated] MLH1 Rabbit mAb
The protein encoded by this gene can heterodimerize with mismatch repair endonuclease PMS2 to form MutL alpha, part of the DNA mismatch repair system. When MutL alpha is bound by MutS beta and some accessory proteins, the PMS2 subunit of MutL alpha introduces a single-strand break near DNA mismatches, providing an entry point for exonuclease degradation. The encoded protein is also involved in DNA damage signaling and can heterodimerize with DNA mismatch repair protein MLH3 to form MutL gamma, which is involved in meiosis. This gene was identified as a locus frequently mutated in hereditary nonpolyposis colon cancer (HNPCC).
Immunogen Information about [KO Validated] MLH1 Rabbit mAb (A4858)
Immunogen:A synthetic peptide corresponding to a sequence within amino acids 350-450 of human MLH1 (NP_000240.1).
Sequence:PGLAGPSGEMVKSTTSLTSSSTSGSSDKVYAHQMVRTDSREQKLDAFLQPLSKPLSSQPQAIVTEDKTDISSGRARQQDEEMLELPAPAEVAAKNQSLEGD
Gene ID:4292
Swiss prot:P40692
Synonyms:FCC2; COCA2; HNPCC; MLH-1; hMLH1; HNPCC2; LYNCH2; MMRCS1; H1
Calculated MW:85kDa
Observed MW:85kDa
Images of [KO Validated] MLH1 Rabbit mAb (A4858)
Western blot analysis of extracts of mouse brain, using MLH1 antibody (A4858) at1:60000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 180s.
Western blot analysis of extracts from normal (control) and MLH1 knockout (KO) HeLa cells, using MLH1 antibody (A4858) at1:60000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 180s.
Immunohistochemistry analysis of paraffin-embedded human colon carcinoma using [KO Validated] MLH1 Rabbit mAb (A4858) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
Please remember our product information: [KO Validated] MLH1 Rabbit mAb (Catalog Number: A4858) Abclonal