Description

A19030: [KO Validated] CDX2 Rabbit mAb

This gene is a member of the caudal-related homeobox transcription factor gene family. The encoded protein is a major regulator of intestine-specific genes involved in cell growth an differentiation. This protein also plays a role in early embryonic development of the intestinal tract. Aberrant expression of this gene is associated with intestinal inflammation and tumorigenesis.

Immunogen Information about [KO Validated] CDX2 Rabbit mAb (A19030)

Immunogen：A synthetic peptide corresponding to a sequence within amino acids 1-100 of human CDX2 (Q99626).
Sequence：MYVSYLLDKDVSMYPSSVRHSGGLNLAPQNFVSPPQYPDYGGYHVAAAAAAAANLDSAQSPGPSWPAAYGAPLREDWNGYAPGGAAAAANAVAHGLNGGS
Gene ID：1045
Swiss prot：Q99626
Synonyms：CDX3; CDX-3; CDX2/AS; X2
Calculated MW：34kDa
Observed MW：38kDa

Images of [KO Validated] CDX2 Rabbit mAb (A19030)

Western blot analysis of various lysates using [KO Validated] CDX2 Rabbit mAb (A19030) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 3min.

Western blot analysis of lysates from wild type(WT) and CDX2 knockout (KO) 293T cells, using [KO Validated] CDX2 Rabbit mAb (A19030) at 1:500 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.

Immunohistochemistry analysis of CDX2 in paraffin-embedded human appendix using [KO Validated] CDX2 Rabbit mAb (A19030) at dilution of 1:800 (40x lens).Perform high pressure antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.

Immunohistochemistry analysis of CDX2 in paraffin-embedded human colon carcinoma using [KO Validated] CDX2 Rabbit mAb (A19030) at dilution of 1:800 (40x lens).Perform high pressure antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.

Confocal imaging of Human colon using [KO Validated] CDX2 Rabbit mAb (A19030, dilution 1:100)(Red). DAPI was used for nuclear staining (blue). Objective: 40x.

Immunoprecipitation analysis of 600 μg extracts of 293T cells using 3 μg CDX2 antibody (A19030). Western blot was performed from the immunoprecipitate using CDX2 antibody (A19030) at a dilution of 1:500.

Please remember our product information: [KO Validated] CDX2 Rabbit mAb (Catalog Number: A19030) Abclonal