Human IgG1 (Fc) Rabbit mAb (A21233)
$148.00 – $548.00
Abclonal Human IgG1 (Fc) Rabbit mAb (Catalog Number: A21233) Predicted to enable antigen binding activity and immunoglobulin receptor binding activity.
- Details & Specifications
- References
- More Offers
| Catalog No. | A21233 |
|---|---|
| Product Name | Human IgG1 (Fc) Rabbit mAb (A21233) |
| Supplier Name | ABclonal, Inc. |
| Brand Name | Abclonal |
| Gene Name | IGHG1 |
| Protein Name | IGHG1 |
| Uniprot/Swissprot ID | P01857,P01859,P01860,P01861 |
| Gene ID | 3500 |
| Clone | ARC53385 |
| Clonality | Monoclonal |
| Source/Host | Rabbit |
| Reactivity | Human |
| Conjugate | Unconjugated |
| Note | Products will be shipped from the warehouse in Massachusetts. Promotion is running from time to time. Welcome to send a request for quote to message@sydlabs.com. |
| Order Offline | Syd Labs, Inc. 4 Avenue E, Hopkinton, MA 01748 USA. Phone: 1-617-401-8149 Fax: 1-617-606-5019 Email: message@sydlabs.com |
Description
A21233: Human IgG1 (Fc) Rabbit mAb
Predicted to enable antigen binding activity and immunoglobulin receptor binding activity. Predicted to be involved in several processes, including activation of immune response; defense response to other organism; and phagocytosis. Predicted to act upstream of or within several processes, including immunoglobulin mediated immune response; positive regulation of hypersensitivity; and positive regulation of phagocytosis. Located in extracellular space.
Immunogen Information about Human IgG1 (Fc) Rabbit mAb (A21233)
Immunogen:Recombinant fusion protein containing a sequence corresponding to amino acids 100-330 of human IgG1 (Fc) (P01857).
Sequence:PKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
Gene ID:3500
Swiss prot:P01857, P01859, P01860, P01861
Synonyms:
Calculated MW:44kDa
Observed MW:50kDa
Images of Human IgG1 (Fc) Rabbit mAb (A21233)

Western blot analysis of lysates from human plasma, using Human IgG1 (Fc) Rabbit mAb (A21233) at 1:4000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.

Immunohistochemistry analysis of Human IgG1 (Fc) in paraffin-embedded human tonsil using Human IgG1 (Fc) Rabbit mAb (A21233) at dilution of 1:5000 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

Confocal imaging of human tonsil using Human IgG1 (Fc) Rabbit mAb (A21233, at dilution of 1:100) (Red). DAPI was used for nuclear staining (blue). Objective: 40x. Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IF staining protocol.
Please remember our product information: Human IgG1 (Fc) Rabbit mAb (Catalog Number: A21233) Abclonal





