Glucagon Rabbit mAb (A22702)
$148.00 – $548.00
Abclonal Glucagon Rabbit mAb (Catalog Number: A22702) encoded by this gene is actually a preproprotein that is cleaved into four distinct mature peptides.
- Product Details
- Description
- Additional information
- More Offers
| Catalog No. | A22702 |
|---|---|
| Product Name | Glucagon Rabbit mAb (A22702) |
| Supplier Name | ABclonal, Inc. |
| Brand Name | Abclonal |
| Synonyms | GLP1; GLP2; GRPP; GLP-1 |
| Gene Name | GCG |
| Protein Name | GCG |
| Uniprot/Swissprot ID | P01275 |
| Entrez GeneID | 2641 |
| Clone | ARC56934 |
| Clonality | Monoclonal |
| Source/Host | Rabbit |
| Applications | WB, IHC-P, IF/ICC |
| Reactivity | Human, Mouse, Rat |
| Conjugate | Unconjugated |
| Note | Products will be shipped from the warehouse in Massachusetts. Promotion is running from time to time. Welcome to send a request for quote to message@sydlabs.com. |
| Order Offline | Syd Labs, Inc. 4 Avenue E, Hopkinton, MA 01748 USA. Phone: 1-617-401-8149 Fax: 1-617-606-5019 Email: message@sydlabs.com |
Description
A22702: Glucagon Rabbit mAb
The protein encoded by this gene is actually a preproprotein that is cleaved into four distinct mature peptides. One of these, glucagon, is a pancreatic hormone that counteracts the glucose-lowering action of insulin by stimulating glycogenolysis and gluconeogenesis. Glucagon is a ligand for a specific G-protein linked receptor whose signalling pathway controls cell proliferation. Two of the other peptides are secreted from gut endocrine cells and promote nutrient absorption through distinct mechanisms. Finally, the fourth peptide is similar to glicentin, an active enteroglucagon.
Immunogen Information about Glucagon Rabbit mAb (A22702)
Immunogen：A synthetic peptide corresponding to a sequence within amino acids 21-120 of human Glucagon (NP_002045.1).
Sequence：RSLQDTEEKSRSFSASQADPLSDPDQMNEDKRHSQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNRNNIAKRHDEFERHAEGTFTSDVSSYLEGQAAKEFI
Gene ID：2641
Swiss prot：P01275
Synonyms：GLP1; GLP2; GRPP; GLP-1; Glucagon
Calculated MW：21kDa
Observed MW：20kDa
Images of Glucagon Rabbit mAb (A22702)
Western blot analysis of various lysates, using Glucagon Rabbit mAb (A22702) at 1:5000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 180s.
Immunohistochemistry analysis of Glucagon in paraffin-embedded human pancreas using Glucagon Rabbit mAb (A22702) at dilution of 1:10000 (40x lens).Perform high pressure antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.
Confocal imaging of human pancreas using Glucagon Rabbit mAb (A22702, dilution 1:500)(Red). DAPI was used for nuclear staining (blue). Objective: 60x.
Confocal imaging of mouse pancreas using Glucagon Rabbit mAb (A22702, dilution 1:500)(Red). DAPI was used for nuclear staining (blue). Objective: 60x.
Confocal imaging of rat pancreas using Glucagon Rabbit mAb (A22702, dilution 1:500)(Red). DAPI was used for nuclear staining (blue). Objective: 60x.
Please remember our product information: Glucagon Rabbit mAb (Catalog Number: A22702) Abclonal
Additional information
| Ship from Country | USA |
|---|---|
| Size | 20 ul, 100 ul, 200 ul, 50 ul |