EpCAM Rabbit mAb (A23075)

EpCAM Rabbit mAb (A23075)

EpCAM Rabbit mAb (A23075)

$148.00$548.00

In stock

$148.00$548.00

Abclonal EpCAM Rabbit mAb (Catalog Number: A23075) encodes a carcinoma-associated antigen and is a member of a family that includes at least two type I membrane proteins.

Store
SKU: A23075 Categories: ,
Clear
View cart
Order Offline:
Phone: 1-617-401-8149
Fax: 1-617-606-5019
Email: message@sydlabs.com
Catalog No. A23075
Product NameEpCAM Rabbit mAb (A23075)
Supplier Name ABclonal, Inc.
Brand Name Abclonal
Synonyms ESA; KSA; M4S1; MK-1; DIAR5; EGP-2; EGP40; KS1/4; MIC18; TROP1; BerEp4; EGP314; HNPCC8; LYNCH8; MOC-31; Ber-Ep4; TACSTD1
Gene Name EPCAM
Protein Name EPCAM
Uniprot/Swissprot ID P16422
Gene ID 4072
Clone ARC57675
Clonality Monoclonal
Source/Host Rabbit
Reactivity Human
Conjugate Unconjugated
Note Products will be shipped from the warehouse in Massachusetts. Promotion is running from time to time. Welcome to send a request for quote to message@sydlabs.com.
Order Offline Syd Labs, Inc. 4 Avenue E, Hopkinton, MA 01748 USA. Phone: 1-617-401-8149 Fax: 1-617-606-5019 Email: message@sydlabs.com

Description

A23075: EpCAM Rabbit mAb

This gene encodes a carcinoma-associated antigen and is a member of a family that includes at least two type I membrane proteins. This antigen is expressed on most normal epithelial cells and gastrointestinal carcinomas and functions as a homotypic calcium-independent cell adhesion molecule. The antigen is being used as a target for immunotherapy treatment of human carcinomas. Mutations in this gene result in congenital tufting enteropathy.

Immunogen Information about EpCAM Rabbit mAb (A23075)

Immunogen:Recombinant fusion protein containing a sequence corresponding to amino acids 24-265 of human EpCAM (NP_002345.2).
Sequence:QEECVCENYKLAVNCFVNNNRQCQCTSVGAQNTVICSKLAAKCLVMKAEMNGSKLGRRAKPEGALQNNDGLYDPDCDESGLFKAKQCNGTSMCWCVNTAGVRRTDKDTEITCSERVRTYWIIIELKHKAREKPYDSKSLRTALQKEITTRYQLDPKFITSILYENNVITIDLVQNSSQKTQNDVDIADVAYYFEKDVKGESLFHSKKMDLTVNGEQLDLDPGQTLIYYVDEKAPEFSMQGLK
Gene ID:4072
Swiss prot:P16422
Synonyms:ESA; KSA; M4S1; MK-1; DIAR5; EGP-2; EGP40; KS1/4; MIC18; TROP1; BerEp4; EGP314; HNPCC8; LYNCH8; MOC-31; Ber-Ep4; TACSTD1; EpCAM
Calculated MW:35kDa
Observed MW:40kDa

Images of EpCAM Rabbit mAb (A23075)

Western blot analysis of various lysates, using EpCAM antibody (A23075) at 1:40000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 180s.

Immunohistochemistry analysis of paraffin-embedded human colon carcinoma using EpCAM Rabbit mAb (A23075) at dilution of 1:200 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

Immunohistochemistry analysis of paraffin-embedded human kidney using EpCAM Rabbit mAb (A23075) at dilution of 1:200 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

Please remember our product information: EpCAM Rabbit mAb (Catalog Number: A23075) Abclonal