EpCAM Rabbit mAb (A23075)
$148.00 – $548.00
Abclonal EpCAM Rabbit mAb (Catalog Number: A23075) encodes a carcinoma-associated antigen and is a member of a family that includes at least two type I membrane proteins.
- Details & Specifications
- References
- More Offers
| Catalog No. | A23075 |
|---|---|
| Product Name | EpCAM Rabbit mAb (A23075) |
| Supplier Name | ABclonal, Inc. |
| Brand Name | Abclonal |
| Synonyms | ESA; KSA; M4S1; MK-1; DIAR5; EGP-2; EGP40; KS1/4; MIC18; TROP1; BerEp4; EGP314; HNPCC8; LYNCH8; MOC-31; Ber-Ep4; TACSTD1 |
| Gene Name | EPCAM |
| Protein Name | EPCAM |
| Uniprot/Swissprot ID | P16422 |
| Gene ID | 4072 |
| Clone | ARC57675 |
| Clonality | Monoclonal |
| Source/Host | Rabbit |
| Reactivity | Human |
| Conjugate | Unconjugated |
| Note | Products will be shipped from the warehouse in Massachusetts. Promotion is running from time to time. Welcome to send a request for quote to message@sydlabs.com. |
| Order Offline | Syd Labs, Inc. 4 Avenue E, Hopkinton, MA 01748 USA. Phone: 1-617-401-8149 Fax: 1-617-606-5019 Email: message@sydlabs.com |
Description
A23075: EpCAM Rabbit mAb
This gene encodes a carcinoma-associated antigen and is a member of a family that includes at least two type I membrane proteins. This antigen is expressed on most normal epithelial cells and gastrointestinal carcinomas and functions as a homotypic calcium-independent cell adhesion molecule. The antigen is being used as a target for immunotherapy treatment of human carcinomas. Mutations in this gene result in congenital tufting enteropathy.
Immunogen Information about EpCAM Rabbit mAb (A23075)
Immunogen:Recombinant fusion protein containing a sequence corresponding to amino acids 24-265 of human EpCAM (NP_002345.2).
Sequence:QEECVCENYKLAVNCFVNNNRQCQCTSVGAQNTVICSKLAAKCLVMKAEMNGSKLGRRAKPEGALQNNDGLYDPDCDESGLFKAKQCNGTSMCWCVNTAGVRRTDKDTEITCSERVRTYWIIIELKHKAREKPYDSKSLRTALQKEITTRYQLDPKFITSILYENNVITIDLVQNSSQKTQNDVDIADVAYYFEKDVKGESLFHSKKMDLTVNGEQLDLDPGQTLIYYVDEKAPEFSMQGLK
Gene ID:4072
Swiss prot:P16422
Synonyms:ESA; KSA; M4S1; MK-1; DIAR5; EGP-2; EGP40; KS1/4; MIC18; TROP1; BerEp4; EGP314; HNPCC8; LYNCH8; MOC-31; Ber-Ep4; TACSTD1; EpCAM
Calculated MW:35kDa
Observed MW:40kDa
Images of EpCAM Rabbit mAb (A23075)

Western blot analysis of various lysates, using EpCAM antibody (A23075) at 1:40000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 180s.

Immunohistochemistry analysis of paraffin-embedded human colon carcinoma using EpCAM Rabbit mAb (A23075) at dilution of 1:200 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

Immunohistochemistry analysis of paraffin-embedded human kidney using EpCAM Rabbit mAb (A23075) at dilution of 1:200 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
Please remember our product information: EpCAM Rabbit mAb (Catalog Number: A23075) Abclonal





