CD79a Rabbit mAb (A22452)
$148.00 – $548.00
Abclonal CD79a Rabbit mAb (Catalog Number: A22452) The B lymphocyte antigen receptor is a multimeric complex that includes the antigen-specific component, surface immunoglobulin (Ig).
- Details & Specifications
- References
- More Offers
| Catalog No. | A22452 |
|---|---|
| Product Name | CD79a Rabbit mAb (A22452) |
| Supplier Name | ABclonal, Inc. |
| Brand Name | Abclonal |
| Synonyms | IGA; MB1; MB-1; IGAlpha |
| Gene Name | CD79A |
| Protein Name | CD79A |
| Uniprot/Swissprot ID | P11912 |
| Gene ID | 973 |
| Clone | ARC51145 |
| Clonality | Monoclonal |
| Source/Host | Rabbit |
| Reactivity | Human,Mouse,Rat |
| Conjugate | Unconjugated |
| Note | Products will be shipped from the warehouse in Massachusetts. Promotion is running from time to time. Welcome to send a request for quote to message@sydlabs.com. |
| Order Offline | Syd Labs, Inc. 4 Avenue E, Hopkinton, MA 01748 USA. Phone: 1-617-401-8149 Fax: 1-617-606-5019 Email: message@sydlabs.com |
Description
A22452: CD79a Rabbit mAb
The B lymphocyte antigen receptor is a multimeric complex that includes the antigen-specific component, surface immunoglobulin (Ig). Surface Ig non-covalently associates with two other proteins, Ig-alpha and Ig-beta, which are necessary for expression and function of the B-cell antigen receptor. This gene encodes the Ig-alpha protein of the B-cell antigen component. Alternatively spliced transcript variants encoding different isoforms have been described.
Immunogen Information about CD79a Rabbit mAb (A22452)
Immunogen：Recombinant fusion protein containing a sequence corresponding to amino acids 165-225 of human CD79a (NP_001774.1).
Sequence：FRKRWQNEKLGLDAGDEYEDENLYEGLNLDDCSMYEDISRGLQGTYQDVGSLNIGDVQLEK
Gene ID：973
Swiss prot：P11912
Synonyms：IGA; MB1; MB-1; IGAlpha; CD79a
Calculated MW：25kDa
Observed MW：45-55kDa
Images of CD79a Rabbit mAb (A22452)
Western blot analysis of various lysates, using CD79a antibody (A22452) at 1:10000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 3s.
Western blot analysis of various lysates, using CD79a antibody (A22452) at 1:10000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 180s.
Immunohistochemistry analysis of paraffin-embedded human breast using CD79a Rabbit mAb (A22452) at dilution of 1:200 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
Immunohistochemistry analysis of paraffin-embedded human colon using CD79a Rabbit mAb (A22452) at dilution of 1:200 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
Immunohistochemistry analysis of paraffin-embedded human extranodal NK-T cell lymphoma using CD79a Rabbit mAb (A22452) at dilution of 1:200 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
Immunohistochemistry analysis of paraffin-embedded human tonsil using CD79a Rabbit mAb (A22452) at dilution of 1:200 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
Immunofluorescence analysis of Daudi and Jurkat(Negative sample） cells using CD79a Rabbit mAb (A22452) at dilution of 1:50 (40x lens). Blue: DAPI for nuclear staining.
Please remember our product information: CD79a Rabbit mAb (Catalog Number: A22452) Abclonal