CD7 Rabbit mAb (A9560)
$148.00 – $548.00
Abclonal CD7 Rabbit mAb (Catalog Number: A9560) encodes a transmembrane protein which is a member of the immunoglobulin superfamily. This protein is found on thymocytes and mature T cells.
- Details & Specifications
- References
| Catalog No. | A9560 |
|---|---|
| Product Name | CD7 Rabbit mAb (A9560) |
| Supplier Name | ABclonal, Inc. |
| Brand Name | Abclonal |
| Synonyms | GP40; TP41; Tp40; LEU-9 |
| Gene Name | CD7 |
| Protein Name | CD7 |
| Uniprot/Swissprot ID | P09564 |
| Gene ID | 924 |
| Clone | ARC1634 |
| Clonality | Monoclonal |
| Source/Host | Rabbit |
| Reactivity | Human |
| Conjugate | Unconjugated |
| Note | Products will be shipped from the warehouse in Massachusetts. Promotion is running from time to time. Welcome to send a request for quote to message@sydlabs.com. |
| Order Offline | Syd Labs, Inc. 4 Avenue E, Hopkinton, MA 01748 USA. Phone: 1-617-401-8149 Fax: 1-617-606-5019 Email: message@sydlabs.com |
Description
A9560: CD7 Rabbit mAb
This gene encodes a transmembrane protein which is a member of the immunoglobulin superfamily. This protein is found on thymocytes and mature T cells. It plays an essential role in T-cell interactions and also in T-cell/B-cell interaction during early lymphoid development.
Immunogen Information about CD7 Rabbit mAb (A9560)
Immunogen:A synthetic peptide corresponding to a sequence within amino acids 141-240 of human CD7 (P09564).
Sequence:RCSDAPPRASALPAPPTGSALPDPQTASALPDPPAASALPAALAVISFLLGLGLGVACVLARTQIKKLCSWRDKNSAACVVYEDMSHSRCNTLSSPNQYQ
Gene ID:924
Swiss prot:P09564
Synonyms:GP40; TP41; Tp40; LEU-9; CD7
Calculated MW:25kDa
Observed MW:37kDa
Images of CD7 Rabbit mAb (A9560)

Western blot analysis of extracts of Jurkat cells, using CD7 Rabbit mAb (A9560) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.

Immunohistochemistry analysis of paraffin-embedded human colon carcinoma using CD7 Rabbit mAb (A9560) at dilution of 1:10000 (40x lens).Perform high pressure antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.

Immunohistochemistry analysis of paraffin-embedded human tonsil using CD7 Rabbit mAb (A9560) at dilution of 1:10000 (40x lens).Perform high pressure antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.
Please remember our product information: CD7 Rabbit mAb (Catalog Number: A9560) Abclonal





