CD7 Rabbit mAb (A9560)

CD7 Rabbit mAb (A9560)

CD7 Rabbit mAb (A9560)

$148.00$548.00

In stock

$148.00$548.00

Abclonal CD7 Rabbit mAb (Catalog Number: A9560) encodes a transmembrane protein which is a member of the immunoglobulin superfamily. This protein is found on thymocytes and mature T cells.

Store
SKU: A9560 Categories: ,
Clear
View cart
Order Offline:
Phone: 1-617-401-8149
Fax: 1-617-606-5019
Email: message@sydlabs.com
Catalog No. A9560
Product NameCD7 Rabbit mAb (A9560)
Supplier Name ABclonal, Inc.
Brand Name Abclonal
Synonyms GP40; TP41; Tp40; LEU-9
Gene Name CD7
Protein Name CD7
Uniprot/Swissprot ID P09564
Gene ID 924
Clone ARC1634
Clonality Monoclonal
Source/Host Rabbit
Reactivity Human
Conjugate Unconjugated
Note Products will be shipped from the warehouse in Massachusetts. Promotion is running from time to time. Welcome to send a request for quote to message@sydlabs.com.
Order Offline Syd Labs, Inc. 4 Avenue E, Hopkinton, MA 01748 USA. Phone: 1-617-401-8149 Fax: 1-617-606-5019 Email: message@sydlabs.com

Description

A9560: CD7 Rabbit mAb

This gene encodes a transmembrane protein which is a member of the immunoglobulin superfamily. This protein is found on thymocytes and mature T cells. It plays an essential role in T-cell interactions and also in T-cell/B-cell interaction during early lymphoid development.

Immunogen Information about CD7 Rabbit mAb (A9560)

Immunogen:A synthetic peptide corresponding to a sequence within amino acids 141-240 of human CD7 (P09564).
Sequence:RCSDAPPRASALPAPPTGSALPDPQTASALPDPPAASALPAALAVISFLLGLGLGVACVLARTQIKKLCSWRDKNSAACVVYEDMSHSRCNTLSSPNQYQ
Gene ID:924
Swiss prot:P09564
Synonyms:GP40; TP41; Tp40; LEU-9; CD7
Calculated MW:25kDa
Observed MW:37kDa

Images of CD7 Rabbit mAb (A9560)

Western blot analysis of extracts of Jurkat cells, using CD7 Rabbit mAb (A9560) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.

Immunohistochemistry analysis of paraffin-embedded human colon carcinoma using CD7 Rabbit mAb (A9560) at dilution of 1:10000 (40x lens).Perform high pressure antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.

Immunohistochemistry analysis of paraffin-embedded human tonsil using CD7 Rabbit mAb (A9560) at dilution of 1:10000 (40x lens).Perform high pressure antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.

Please remember our product information: CD7 Rabbit mAb (Catalog Number: A9560) Abclonal