CD31/PECAM1 Rabbit mAb (A20228)

CD31/PECAM1 Rabbit mAb (A20228)

CD31/PECAM1 Rabbit mAb (A20228)

$148.00$548.00

In stock

$148.00$548.00

Abclonal CD31/PECAM1 Rabbit mAb (Catalog Number: A20228) encoded by this gene is found on the surface of platelets, monocytes, neutrophils, and some types of T-cells, and makes up a large portion of endothelial cell intercellular junctions.

Store
SKU: A20228 Categories: ,
Clear
View cart
Order Offline:
Phone: 1-617-401-8149
Fax: 1-617-606-5019
Email: message@sydlabs.com
Catalog No. A20228
Product NameCD31/PECAM1 Rabbit mAb (A20228)
Supplier Name ABclonal, Inc.
Brand Name Abclonal
Synonyms CD31; PECA1; GPIIA'; PECAM-1; endoCAM; CD31/EndoCAM
Gene Name PECAM1
Protein Name PECAM1
Uniprot/Swissprot ID Q08481
Gene ID 5175
Clone ARC5013-19
Clonality Monoclonal
Source/Host Rabbit
Reactivity Human
Conjugate Unconjugated
Note Products will be shipped from the warehouse in Massachusetts. Promotion is running from time to time. Welcome to send a request for quote to message@sydlabs.com.
Order Offline Syd Labs, Inc. 4 Avenue E, Hopkinton, MA 01748 USA. Phone: 1-617-401-8149 Fax: 1-617-606-5019 Email: message@sydlabs.com

Description

A20228: CD31/PECAM1 Rabbit mAb

The protein encoded by this gene is found on the surface of platelets, monocytes, neutrophils, and some types of T-cells, and makes up a large portion of endothelial cell intercellular junctions. The encoded protein is a member of the immunoglobulin superfamily and is likely involved in leukocyte migration, angiogenesis, and integrin activation.

Immunogen Information about CD31/PECAM1 Rabbit mAb (A20228)

Immunogen:Recombinant fusion protein containing a sequence corresponding to amino acids 630-738 of CD31/PECAM1 (NP_000433.4).
Sequence:AKQMPVEMSRPAVPLLNSNNEKMSDPNMEANSHYGHNDDVRNHAMKPINDNKEPLNSDVQYTEVQVSSAESHKDLGKKDTETVYSEVRKAVPDAVESRYSRTEGSLDGT
Gene ID:5175
Swiss prot:Q08481
Synonyms:CD31; PECA1; GPIIA’; PECAM-1; endoCAM; CD31/EndoCAM; CD31/PECAM1
Calculated MW:83KDa
Observed MW:130-140kDa

Images of CD31/PECAM1 Rabbit mAb (A20228)

Western blot analysis of various lysates using CD31/PECAM1 Rabbit mAb (A20228) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 3s.

Immunohistochemistry analysis of CD31/PECAM1 in paraffin-embedded human kidney using CD31/PECAM1 Rabbit mAb (A20228) at dilution of 1:200 (40x lens).Perform high pressure antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.

Immunohistochemistry analysis of CD31/PECAM1 in paraffin-embedded human tonsil using CD31/PECAM1 Rabbit mAb (A20228) at dilution of 1:200 (40x lens).Perform high pressure antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.

Immunoprecipitation analysis of 300 μg extracts of Jurkat cells using 3 μg CD31/PECAM1 antibody (A20228). Western blot was performed from the immunoprecipitate using CD31/PECAM1 antibody (A20228) at a dilution of 1:1000.

Please remember our product information: CD31/PECAM1 Rabbit mAb (Catalog Number: A20228) Abclonal