CD31/PECAM1 Rabbit mAb (A20228)
$148.00 – $548.00
Abclonal CD31/PECAM1 Rabbit mAb (Catalog Number: A20228) encoded by this gene is found on the surface of platelets, monocytes, neutrophils, and some types of T-cells, and makes up a large portion of endothelial cell intercellular junctions.
- Details & Specifications
- References
| Catalog No. | A20228 |
|---|---|
| Product Name | CD31/PECAM1 Rabbit mAb (A20228) |
| Supplier Name | ABclonal, Inc. |
| Brand Name | Abclonal |
| Synonyms | CD31; PECA1; GPIIA'; PECAM-1; endoCAM; CD31/EndoCAM |
| Gene Name | PECAM1 |
| Protein Name | PECAM1 |
| Uniprot/Swissprot ID | Q08481 |
| Gene ID | 5175 |
| Clone | ARC5013-19 |
| Clonality | Monoclonal |
| Source/Host | Rabbit |
| Reactivity | Human |
| Conjugate | Unconjugated |
| Note | Products will be shipped from the warehouse in Massachusetts. Promotion is running from time to time. Welcome to send a request for quote to message@sydlabs.com. |
| Order Offline | Syd Labs, Inc. 4 Avenue E, Hopkinton, MA 01748 USA. Phone: 1-617-401-8149 Fax: 1-617-606-5019 Email: message@sydlabs.com |
Description
A20228: CD31/PECAM1 Rabbit mAb
The protein encoded by this gene is found on the surface of platelets, monocytes, neutrophils, and some types of T-cells, and makes up a large portion of endothelial cell intercellular junctions. The encoded protein is a member of the immunoglobulin superfamily and is likely involved in leukocyte migration, angiogenesis, and integrin activation.
Immunogen Information about CD31/PECAM1 Rabbit mAb (A20228)
Immunogen:Recombinant fusion protein containing a sequence corresponding to amino acids 630-738 of CD31/PECAM1 (NP_000433.4).
Sequence:AKQMPVEMSRPAVPLLNSNNEKMSDPNMEANSHYGHNDDVRNHAMKPINDNKEPLNSDVQYTEVQVSSAESHKDLGKKDTETVYSEVRKAVPDAVESRYSRTEGSLDGT
Gene ID:5175
Swiss prot:Q08481
Synonyms:CD31; PECA1; GPIIA’; PECAM-1; endoCAM; CD31/EndoCAM; CD31/PECAM1
Calculated MW:83KDa
Observed MW:130-140kDa
Images of CD31/PECAM1 Rabbit mAb (A20228)

Western blot analysis of various lysates using CD31/PECAM1 Rabbit mAb (A20228) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 3s.

Immunohistochemistry analysis of CD31/PECAM1 in paraffin-embedded human kidney using CD31/PECAM1 Rabbit mAb (A20228) at dilution of 1:200 (40x lens).Perform high pressure antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.

Immunohistochemistry analysis of CD31/PECAM1 in paraffin-embedded human tonsil using CD31/PECAM1 Rabbit mAb (A20228) at dilution of 1:200 (40x lens).Perform high pressure antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.

Immunoprecipitation analysis of 300 μg extracts of Jurkat cells using 3 μg CD31/PECAM1 antibody (A20228). Western blot was performed from the immunoprecipitate using CD31/PECAM1 antibody (A20228) at a dilution of 1:1000.
Please remember our product information: CD31/PECAM1 Rabbit mAb (Catalog Number: A20228) Abclonal






