CD31/PECAM1 Rabbit mAb (A19014)

CD31/PECAM1 Rabbit mAb (A19014)

CD31/PECAM1 Rabbit mAb (A19014)

$148.00$548.00

In stock

$148.00$548.00

Abclonal CD31/PECAM1 Rabbit mAb (Catalog Number: A19014) encoded by this gene is found on the surface of platelets, monocytes, neutrophils, and some types of T-cells, and makes up a large portion of endothelial cell intercellular junctions.

Store
SKU: A19014 Categories: ,
Clear
View cart
Order Offline:
Phone: 1-617-401-8149
Fax: 1-617-606-5019
Email: message@sydlabs.com
Catalog No. A19014
Product NameCD31/PECAM1 Rabbit mAb (A19014)
Supplier Name ABclonal, Inc.
Brand Name Abclonal
Synonyms CD31; PECA1; GPIIA'; PECAM-1; endoCAM; CD31/EndoCAM
Gene Name PECAM1
Protein Name PECAM1
Uniprot/Swissprot ID P16284
Gene ID 5175
Clone ARC50362
Clonality Monoclonal
Source/Host Rabbit
Reactivity Human, Mouse, Rat
Conjugate Unconjugated
Note Products will be shipped from the warehouse in Massachusetts. Promotion is running from time to time. Welcome to send a request for quote to message@sydlabs.com.
Order Offline Syd Labs, Inc. 4 Avenue E, Hopkinton, MA 01748 USA. Phone: 1-617-401-8149 Fax: 1-617-606-5019 Email: message@sydlabs.com

Description

A19014: CD31/PECAM1 Rabbit mAb

The protein encoded by this gene is found on the surface of platelets, monocytes, neutrophils, and some types of T-cells, and makes up a large portion of endothelial cell intercellular junctions. The encoded protein is a member of the immunoglobulin superfamily and is likely involved in leukocyte migration, angiogenesis, and integrin activation.

Immunogen Information about CD31/PECAM1 Rabbit mAb (A19014)

Immunogen:Recombinant fusion protein containing a sequence corresponding to amino acids 630-738 of CD31/PECAM1 (NP_000433.4).
Sequence:AKQMPVEMSRPAVPLLNSNNEKMSDPNMEANSHYGHNDDVRNHAMKPINDNKEPLNSDVQYTEVQVSSAESHKDLGKKDTETVYSEVRKAVPDAVESRYSRTEGSLDGT
Gene ID:5175
Swiss prot:P16284
Synonyms:CD31; PECA1; GPIIA’; PECAM-1; endoCAM; CD31/EndoCAM; CD31/PECAM1
Calculated MW:83kDa
Observed MW:135kDa

Images of CD31/PECAM1 Rabbit mAb (A19014)


Western blot analysis of various lysates, using CD31/PECAM1 (A19014) at 1:12500 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 180s.

Western blot analysis of various lysates, using CD31/PECAM1 (A19014) at 1:12500 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 180s.
Western blot analysis of various lysates, using CD31/PECAM1 (A19014) at 1:12500 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25μg per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Enhanced Kit (RM00021). Exposure time: 180s.
Immunohistochemistry analysis of CD31/PECAM1 in paraffin-embedded human kidney using CD31/PECAM1 Rabbit mAb (A19014) at dilution of 1:500 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

Immunohistochemistry analysis of CD31/PECAM1 in paraffin-embedded human liver using CD31/PECAM1 Rabbit mAb (A19014) at dilution of 1:500 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

Immunohistochemistry analysis of CD31/PECAM1 in paraffin-embedded human thyroid using CD31/PECAM1 Rabbit mAb (A19014) at dilution of 1:500 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

Confocal imaging of paraffin-embedded human placenta using CD31/PECAM1 Rabbit mAb (A19014, dilution 1:200) followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) (AS007, dilution 1:500) (Red). DAPI was used for nuclear staining (Blue). Objective: 40x.Perform high pressure antigen retrieval with 0.01M citrate buffer (pH 6.0) prior to IF staining.

Confocal imaging of paraffin-embedded human kidney using CD31/PECAM1 Rabbit mAb (A19014, dilution 1:200) followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) (AS007, dilution 1:500) (Red). DAPI was used for nuclear staining (Blue). Objective: 40x.Perform high pressure antigen retrieval with 0.01M citrate buffer (pH 6.0) prior to IF staining.

Please remember our product information: CD31/PECAM1 Rabbit mAb (Catalog Number: A19014) Abclonal

No more offers for this product!