CD31/PECAM1 Rabbit mAb (A19014)
$148.00 – $548.00
Abclonal CD31/PECAM1 Rabbit mAb (Catalog Number: A19014) encoded by this gene is found on the surface of platelets, monocytes, neutrophils, and some types of T-cells, and makes up a large portion of endothelial cell intercellular junctions.
- Details & Specifications
- References
- More Offers
| Catalog No. | A19014 |
|---|---|
| Product Name | CD31/PECAM1 Rabbit mAb (A19014) |
| Supplier Name | ABclonal, Inc. |
| Brand Name | Abclonal |
| Synonyms | CD31; PECA1; GPIIA'; PECAM-1; endoCAM; CD31/EndoCAM |
| Gene Name | PECAM1 |
| Protein Name | PECAM1 |
| Uniprot/Swissprot ID | P16284 |
| Gene ID | 5175 |
| Clone | ARC50362 |
| Clonality | Monoclonal |
| Source/Host | Rabbit |
| Reactivity | Human, Mouse, Rat |
| Conjugate | Unconjugated |
| Note | Products will be shipped from the warehouse in Massachusetts. Promotion is running from time to time. Welcome to send a request for quote to message@sydlabs.com. |
| Order Offline | Syd Labs, Inc. 4 Avenue E, Hopkinton, MA 01748 USA. Phone: 1-617-401-8149 Fax: 1-617-606-5019 Email: message@sydlabs.com |
Description
A19014: CD31/PECAM1 Rabbit mAb
The protein encoded by this gene is found on the surface of platelets, monocytes, neutrophils, and some types of T-cells, and makes up a large portion of endothelial cell intercellular junctions. The encoded protein is a member of the immunoglobulin superfamily and is likely involved in leukocyte migration, angiogenesis, and integrin activation.
Immunogen Information about CD31/PECAM1 Rabbit mAb (A19014)
Immunogen:Recombinant fusion protein containing a sequence corresponding to amino acids 630-738 of CD31/PECAM1 (NP_000433.4).
Sequence:AKQMPVEMSRPAVPLLNSNNEKMSDPNMEANSHYGHNDDVRNHAMKPINDNKEPLNSDVQYTEVQVSSAESHKDLGKKDTETVYSEVRKAVPDAVESRYSRTEGSLDGT
Gene ID:5175
Swiss prot:P16284
Synonyms:CD31; PECA1; GPIIA’; PECAM-1; endoCAM; CD31/EndoCAM; CD31/PECAM1
Calculated MW:83kDa
Observed MW:135kDa
Images of CD31/PECAM1 Rabbit mAb (A19014)

Western blot analysis of various lysates, using CD31/PECAM1 (A19014) at 1:12500 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 180s.

Western blot analysis of various lysates, using CD31/PECAM1 (A19014) at 1:12500 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 180s.

Immunohistochemistry analysis of CD31/PECAM1 in paraffin-embedded human kidney using CD31/PECAM1 Rabbit mAb (A19014) at dilution of 1:500 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

Immunohistochemistry analysis of CD31/PECAM1 in paraffin-embedded human liver using CD31/PECAM1 Rabbit mAb (A19014) at dilution of 1:500 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

Immunohistochemistry analysis of CD31/PECAM1 in paraffin-embedded human thyroid using CD31/PECAM1 Rabbit mAb (A19014) at dilution of 1:500 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

Confocal imaging of paraffin-embedded human placenta using CD31/PECAM1 Rabbit mAb (A19014, dilution 1:200) followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) (AS007, dilution 1:500) (Red). DAPI was used for nuclear staining (Blue). Objective: 40x.Perform high pressure antigen retrieval with 0.01M citrate buffer (pH 6.0) prior to IF staining.

Confocal imaging of paraffin-embedded human kidney using CD31/PECAM1 Rabbit mAb (A19014, dilution 1:200) followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) (AS007, dilution 1:500) (Red). DAPI was used for nuclear staining (Blue). Objective: 40x.Perform high pressure antigen retrieval with 0.01M citrate buffer (pH 6.0) prior to IF staining.
Please remember our product information: CD31/PECAM1 Rabbit mAb (Catalog Number: A19014) Abclonal







