CD147/BSG Rabbit mAb (A22443)
$148.00 – $548.00
Abclonal CD147/BSG Rabbit mAb (Catalog Number: A22443) encoded by this gene, basigin, is a plasma membrane protein that is important in spermatogenesis, embryo implantation, neural network formation, and tumor progression.
- Details & Specifications
- References
| Catalog No. | A22443 |
|---|---|
| Product Name | CD147/BSG Rabbit mAb (A22443) |
| Supplier Name | ABclonal, Inc. |
| Brand Name | Abclonal |
| Synonyms | OK; 5F7; TCSF; CD147; EMPRIN; HAb18G; EMMPRIN |
| Gene Name | BSG |
| Protein Name | BSG |
| Uniprot/Swissprot ID | P35613 |
| Gene ID | 682 |
| Clone | ARC2742 |
| Clonality | Monoclonal |
| Source/Host | Rabbit |
| Reactivity | Human |
| Conjugate | Unconjugated |
| Note | Products will be shipped from the warehouse in Massachusetts. Promotion is running from time to time. Welcome to send a request for quote to message@sydlabs.com. |
| Order Offline | Syd Labs, Inc. 4 Avenue E, Hopkinton, MA 01748 USA. Phone: 1-617-401-8149 Fax: 1-617-606-5019 Email: message@sydlabs.com |
Description
A22443: CD147/BSG Rabbit mAb
The protein encoded by this gene, basigin, is a plasma membrane protein that is important in spermatogenesis, embryo implantation, neural network formation, and tumor progression. Basigin is also a member of the immunoglobulin superfamily, ubiquitously expressed in various tissues. Multiple transcript variants encoding different isoforms have been found for this gene.
Immunogen Information about CD147/BSG Rabbit mAb (A22443)
Immunogen:A synthetic peptide corresponding to a sequence within amino acids 286-385 of human CD147/BSG (P35613).
Sequence:HIENLNMEADPGQYRCNGTSSKGSDQAIITLRVRSHLAALWPFLGIVAEVLVLVTIIFIYEKRRKPEDVLDDDDAGSAPLKSSGQHQNDKGKNVRQRNSS
Gene ID:682
Swiss prot:P35613
Synonyms:OK; 5F7; TCSF; CD147; EMPRIN; HAb18G; EMMPRIN; CD147/BSG
Calculated MW:42kDa
Observed MW:38-58kDa
Images of CD147/BSG Rabbit mAb (A22443)

Western blot analysis of extracts of various cell lines, using CD147/BSG antibody (A22443) at 1:500 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.

Immunohistochemistry analysis of paraffin-embedded human liver using CD147/BSG Rabbit mAb (A22443) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
Please remember our product information: CD147/BSG Rabbit mAb (Catalog Number: A22443) Abclonal



