ABflo® 647 Rabbit anti-Pig CD8a mAb (A23011)
$140.00 – $388.00
Abclonal ABflo® 647 Rabbit anti-Pig CD8a mAb (Catalog Number: A23011) is a cell surface glycoprotein found on most cytotoxic T lymphocytes that mediates efficient cell-cell interactions within the immune system.
- Details & Specifications
- References
| Catalog No. | A23011 |
|---|---|
| Product Name | ABflo® 647 Rabbit anti-Pig CD8a mAb (A23011) |
| Supplier Name | ABclonal, Inc. |
| Brand Name | Abclonal |
| Gene Name | CD8A |
| Protein Name | CD8A |
| Gene ID | 396627 |
| Clonality | Monoclonal |
| Source/Host | Rabbit |
| Reactivity | Pig |
| Conjugate | ABflo® 647. Ex:656nm. Em:670nm. |
| Note | Products will be shipped from the warehouse in Massachusetts. Promotion is running from time to time. Welcome to send a request for quote to message@sydlabs.com. |
| Order Offline | Syd Labs, Inc. 4 Avenue E, Hopkinton, MA 01748 USA. Phone: 1-617-401-8149 Fax: 1-617-606-5019 Email: message@sydlabs.com |
Description
A23011: ABflo® 647 Rabbit anti-Pig CD8a mAb
The CD8 antigen is a cell surface glycoprotein found on most cytotoxic T lymphocytes that mediates efficient cell-cell interactions within the immune system. The CD8 antigen acts as a coreceptor with the T-cell receptor on the T lymphocyte to recognize antigens displayed by an antigen presenting cell in the context of class I MHC molecules. The coreceptor functions as either a homodimer composed of two alpha chains or as a heterodimer composed of one alpha and one beta chain. Both alpha and beta chains share significant homology to immunoglobulin variable light chains. This gene encodes the CD8 alpha chain. Multiple transcript variants encoding different isoforms have been found for this gene. The major protein isoforms of this gene differ by the presence or absence of a transmembrane domain and thus differ in being a membrane-anchored or secreted protein.
Immunogen Information about ABflo® 647 Rabbit anti-Pig CD8a mAb (A23011)
Immunogen:Recombinant fusion protein containing a sequence corresponding to amino acids 25-184 of pig CD8a(XP_005662451.1)
Sequence: SLFRTSPEMVQASLGETVKLRCEVMHSNTLTSCSWLYQKPGAASKPIFLMYLSKTRNKTAEGLDTRYISGYKANDNFYLILHRFREEDQGYYFCSFLSNSVLYFSNFMSVFLPAKPTKTPTTPPPKRTPTKASHAVSVAPEVCRPSGNAVDPRKLDFAC
Gene ID:396627
Swiss prot:
Synonyms:
Calculated MW:26kDa
Observed MW:
Images of ABflo® 647 Rabbit anti-Pig CD8a mAb (A23011)

Flow cytometry:1X10^6 293F cells (negative control, Left) and 293F(Transfection, right) cells were surface-stained with ABflo® 647 Rabbit anti-Pig CD8A mAb(A23011, 5 μl/Test, orange line) or ABflo® 647 Rabbit IgG isotype control (A22070, 5 μl/Test, blue line). Non-fluorescently stained cells was used as blank control (red line).

Flow cytometry:1X10^6 293F(Transfection) cells were surface-stained with ABflo® 647 Rabbit IgG isotype control (A22070, 5 μl/Test, left) or ABflo® 647 Rabbit anti-Pig CD8A mAb(A23011, 5 μl/Test, right).
Please remember our product information: ABflo® 647 Rabbit anti-Pig CD8a mAb (Catalog Number: A23011) Abclonal


