ABflo® 647 Rabbit anti-Human/Monkey CD20 mAb (A22153)
$290.00 – $768.00
Abclonal ABflo® 647 Rabbit anti-Human/Monkey CD20 mAb (Catalog Number: A22153) encodes a member of the membrane-spanning 4A gene family. Members of this nascent protein family are characterized by common structural features and similar intron/exon splice boundaries and display unique expression patterns among hematopoietic cells and nonlymphoid tissues.
- Details & Specifications
- References
- More Offers
| Catalog No. | A22153 |
|---|---|
| Product Name | ABflo® 647 Rabbit anti-Human/Monkey CD20 mAb (A22153) |
| Supplier Name | ABclonal, Inc. |
| Brand Name | Abclonal |
| Synonyms | B1; S7; Bp35; CD20; FMC7; CVID5; LEU-16 |
| Gene Name | MS4A1 |
| Protein Name | MS4A1 |
| Uniprot/Swissprot ID | P12314 |
| Gene ID | 931 |
| Clonality | Monoclonal |
| Source/Host | Rabbit |
| Reactivity | Human, Monkey |
| Conjugate | ABflo® 647. Ex:656nm. Em:670nm. |
| Note | Products will be shipped from the warehouse in Massachusetts. Promotion is running from time to time. Welcome to send a request for quote to message@sydlabs.com. |
| Order Offline | Syd Labs, Inc. 4 Avenue E, Hopkinton, MA 01748 USA. Phone: 1-617-401-8149 Fax: 1-617-606-5019 Email: message@sydlabs.com |
Description
A22153: ABflo® 647 Rabbit anti-Human/Monkey CD20 mAb
This gene encodes a member of the membrane-spanning 4A gene family. Members of this nascent protein family are characterized by common structural features and similar intron/exon splice boundaries and display unique expression patterns among hematopoietic cells and nonlymphoid tissues. This gene encodes a B-lymphocyte surface molecule which plays a role in the development and differentiation of B-cells into plasma cells. This family member is localized to 11q12, among a cluster of family members. Alternative splicing of this gene results in two transcript variants which encode the same protein.
Immunogen Information about ABflo® 647 Rabbit anti-Human/Monkey CD20 mAb (A22153)
Immunogen:A synthetic peptide corresponding to a sequence within amino acids 100-200 of human CD20 (NP_068769.2).
Sequence:LLAATEKNSRKCLVKGKMIMNSLSLFAAISGMILSIMDILNIKISHFLKMESLNFIRAHTPYINIYNCEPANPSEKNSPSTQYCYSIQSLFLGILSVMLIF
Gene ID:931
Swiss prot:P12314
Synonyms:B1; S7; Bp35; CD20; FMC7; CVID5; LEU-16
Calculated MW:14kDa/33kDa
Observed MW:Refer to figures
Images of ABflo® 647 Rabbit anti-Human/Monkey CD20 mAb (A22153)

Flow cytometry:1X10^6 Jurkat cells (negative control, left) and Daudi cells (right) were surface-stained with ABflo® 647 Rabbit anti-Human/Monkey CD20 mAb(A22153, 5 μl/Test, orange line) or ABflo® 647 Rabbit IgG isotype control (A22070, 5 μl/Test, blue line). Non-fluorescently stained cells were used as blank control (red line).

Flow cytometry:1X10^6 Human PBMC were surface-stained with ABflo® 647 Rabbit anti-Human/Monkey CD20 mAb(A22153, 5 μl/Test, orange line) or ABflo® 647 Rabbit IgG isotype control (A22070, 5 μl/Test, blue line).Non-fluorescently stained Human PBMC was used as blank control (red line).

Flow cytometry:1X10^6 Human PBMC cells were surface-stained with ABflo® 647 Rabbit IgG isotype control (A22070, 5 μl/Test, left) or ABflo® 647 Rabbit anti-Human/Monkey CD20 mAb(A22153, 5 μl/Test, right).
Please remember our product information: ABflo® 647 Rabbit anti-Human/Monkey CD20 mAb (Catalog Number: A22153) Abclonal





