ABflo® 647 Rabbit anti-Human ICAM-1/CD54 mAb (A22313)

ABflo® 647 Rabbit anti-Human ICAM-1/CD54 mAb (A22313)

ABflo® 647 Rabbit anti-Human ICAM-1/CD54 mAb (A22313)

$290.00$768.00

In stock

$290.00$768.00

Abclonal ABflo® 647 Rabbit anti-Human ICAM-1/CD54 mAb (Catalog Number: A22313) Intercellular cell adhesion molecule-1 (CD54 or ICAM-1) is a cell surface glycoprotein that belongs to the immunoglobulin superfamily (IgSF) of adhesion molecules.

Store
SKU: A22313 Categories: ,
Clear
View cart
Order Offline:
Phone: 1-617-401-8149
Fax: 1-617-606-5019
Email: message@sydlabs.com
Catalog No. A22313
Product NameABflo® 647 Rabbit anti-Human ICAM-1/CD54 mAb (A22313)
Supplier Name ABclonal, Inc.
Brand Name Abclonal
Synonyms BB2; CD54; P3.58
Gene Name ICAM1
Protein Name ICAM1
Uniprot/Swissprot ID P05362
Gene ID 3383
Clonality Monoclonal
Source/Host Rabbit
Reactivity Human
Conjugate ABflo® 647. Ex:656nm. Em:670nm.
Note Products will be shipped from the warehouse in Massachusetts. Promotion is running from time to time. Welcome to send a request for quote to message@sydlabs.com.
Order Offline Syd Labs, Inc. 4 Avenue E, Hopkinton, MA 01748 USA. Phone: 1-617-401-8149 Fax: 1-617-606-5019 Email: message@sydlabs.com

Description

A22313: ABflo® 647 Rabbit anti-Human ICAM-1/CD54 mAb

Intercellular cell adhesion molecule-1 (CD54 or ICAM-1) is a cell surface glycoprotein that belongs to the immunoglobulin superfamily (IgSF) of adhesion molecules. CD54 is expressed at low levels in diverse cell types, and is induced by cytokines (TNF-α, interleukin-1) and bacterial lipopolysaccharide . Apical localization of CD54 on endothelial cells (or basolateral localization on epithelial cells) is a prerequisite for leukocyte trafficking through the endothelial (or epithelial) barrier . Apical expression of CD54 on epithelial cells mediates pathogen invasion as well as host defense, a pattern also observed in tumors . CD54 also functions as a co-stimulator on antigen presenting cells, binding to its receptor LFA-1 (leukocyte function-associated antigen-1) on the surface of T cells during antigen presentation . Cross-linking of CD54 or binding to its ligand triggers activation of Src family kinases and the Rho/ROCK pathway . Phosphorylation on Tyr485 of CD54 is required for its association with SHP-2. SHP-2 seems essential for CD54-induced Src activation.

Immunogen Information about ABflo® 647 Rabbit anti-Human ICAM-1/CD54 mAb (A22313)

Immunogen:Recombinant fusion protein containing a sequence corresponding to amino acids 28-480 of human ICAM-1/CD54 (NP_000192.2).
Sequence:QTSVSPSKVILPRGGSVLVTCSTSCDQPKLLGIETPLPKKELLLPGNNRKVYELSNVQEDSQPMCYSNCPDGQSTAKTFLTVYWTPERVELAPLPSWQPVGKNLTLRCQVEGGAPRANLTVVLLRGEKELKREPAVGEPAEVTTTVLVRRDHHGANFSCRTELDLRPQGLELFENTSAPYQLQTFVLPATPPQLVSPRVLEVDTQGTVVCSLDGLFPVSEAQVHLALGDQRLNPTVTYGNDSFSAKASVSVTAEDEGTQRLTCAVILGNQSQETLQTVTIYSFPAPNVILTKPEVSEGTEVTVKCEAHPRAKVTLNGVPAQPLGPRAQLLLKATPEDNGRSFSCSATLEVAGQLIHKNQTRELRVLYGPRLDERDCPGNWTWPENSQQTPMCQAWGNPLPELKCLKDGTFPLPIGESVTVTRDLEGTYLCRARSTQGEVTRKVTVNVLSPRYE
Gene ID:3383
Swiss prot:P05362
Synonyms:BB2; CD54; P3.58
Calculated MW:58kDa
Observed MW:

Images of ABflo® 647 Rabbit anti-Human ICAM-1/CD54 mAb (A22313)

Flow cytometry: 1X10^6 293F cells (negative control, left) and Raji cells (right) were surface-stained with ABflo® 647 Rabbit anti-Human ICAM-1/CD54 mAb (A22313, 2 μg/mL, orange line) or ABflo® 647 Rabbit IgG isotype control (A22070, 2 μg/mL, blue line). Non-fluorescently stained cells was used as blank control (red line).

Flow cytometry: 1X10^6 Raji cells were surface-stained with ABflo® 647 Rabbit IgG isotype control (A22070, 5 μl/Test, left) or ABflo® 647 Rabbit anti-Human ICAM-1/CD54 mAb (A22313, 5 μl/Test, right).

Flow cytometry:1X10^6 Human PBMC were surface-stained with ABflo® 647 Rabbit anti-Human ICAM-1/CD54 mAb(A22313, 5 μl/Test, orange line) or ABflo® 647 Rabbit IgG isotype control (A22070, 5 μl/Test, blue line). Non-fluorescently stained cells were used as blank control (red line).

Flow cytometry:1X10^6 Human PBMC were surface-stained with ABflo® 647 Rabbit IgG isotype control (A22070, 5 μl/Test, left) or ABflo® 647 Rabbit anti-Human ICAM-1/CD54 mAb(A22313, 5 μl/Test, right).

Please remember our product information: ABflo® 647 Rabbit anti-Human ICAM-1/CD54 mAb (Catalog Number: A22313) Abclonal