ABflo® 647 Rabbit anti-Human ERG mAb (A22497)

ABflo® 647 Rabbit anti-Human ERG mAb (A22497)

ABflo® 647 Rabbit anti-Human ERG mAb (A22497)

$290.00$768.00

In stock

$290.00$768.00

Abclonal ABflo® 647 Rabbit anti-Human ERG mAb (Catalog Number: A22497) encodes a member of the erythroblast transformation-specific (ETS) family of transcriptions factors.

Store
SKU: A22497 Categories: ,
Clear
View cart
Order Offline:
Phone: 1-617-401-8149
Fax: 1-617-606-5019
Email: message@sydlabs.com
Catalog No. A22497
Product NameABflo® 647 Rabbit anti-Human ERG mAb (A22497)
Supplier Name ABclonal, Inc.
Brand Name Abclonal
Synonyms p55; erg-3
Gene Name ERG
Protein Name ERG
Uniprot/Swissprot ID P11308
Gene ID 2078
Clonality Monoclonal
Source/Host Rabbit
Reactivity Human
Conjugate ABflo® 647. Ex:656nm. Em:670nm.
Note Products will be shipped from the warehouse in Massachusetts. Promotion is running from time to time. Welcome to send a request for quote to message@sydlabs.com.
Order Offline Syd Labs, Inc. 4 Avenue E, Hopkinton, MA 01748 USA. Phone: 1-617-401-8149 Fax: 1-617-606-5019 Email: message@sydlabs.com

Description

A22497: ABflo® 647 Rabbit anti-Human ERG mAb

This gene encodes a member of the erythroblast transformation-specific (ETS) family of transcriptions factors. All members of this family are key regulators of embryonic development, cell proliferation, differentiation, angiogenesis, inflammation, and apoptosis. The protein encoded by this gene is mainly expressed in the nucleus. It contains an ETS DNA-binding domain and a PNT (pointed) domain which is implicated in the self-association of chimeric oncoproteins. This protein is required for platelet adhesion to the subendothelium, inducing vascular cell remodeling. It also regulates hematopoesis, and the differentiation and maturation of megakaryocytic cells. This gene is involved in chromosomal translocations, resulting in different fusion gene products, such as TMPSSR2-ERG and NDRG1-ERG in prostate cancer, EWS-ERG in Ewing’s sarcoma and FUS-ERG in acute myeloid leukemia. More than two dozens of transcript variants generated from combinatorial usage of three alternative promoters and multiple alternative splicing events have been reported, but the full-length nature of many of these variants has not been determined.

Immunogen Information about ABflo® 647 Rabbit anti-Human ERG mAb (A22497)

Immunogen:A synthetic peptide corresponding to a sequence within amino acids 1-100 of human ERG (NP_891548.1).
Sequence:MASTIKEALSVVSEDQSLFECAYGTPHLAKTEMTASSSSDYGQTSKMSPRVPQQDWLSQPPARVTIKMECNPSQVNGSRNSPDECSVAKGGKMVGSPDTV
Gene ID:2078
Swiss prot:P11308
Synonyms:p55; erg-3
Calculated MW:54kDa
Observed MW:

Images of ABflo® 647 Rabbit anti-Human ERG mAb (A22497)

Flow cytometry: 1X10^6 K-562 cells (negative control, left) and MOLT-4 cells (right) were intracellularly-stained with ABflo® 647 Rabbit anti-Human ERG mAb (A22497, 2 μg/mL, orange line) or ABflo® 647 Rabbit IgG isotype control (A22070, 2 μg/mL, blue line). Non-fluorescently stained cells was used as blank control (red line).

Flow cytometry: 1X10^6 MOLT-4 cells were intracellularly-stained with ABflo® 647 Rabbit IgG isotype control (A22070, 5 μl/Test, left) or ABflo® 647 Rabbit anti-Human ERG mAb (A22497, 5 μl/Test, right).

Please remember our product information: ABflo® 647 Rabbit anti-Human ERG mAb (Catalog Number: A22497) Abclonal

No more offers for this product!