ABflo® 647 Rabbit anti-Human CD86 mAb (A21941)

ABflo® 647 Rabbit anti-Human CD86 mAb (A21941)

ABflo® 647 Rabbit anti-Human CD86 mAb (A21941)

$218.00$568.00

In stock

$218.00$568.00

Abclonal ABflo® 647 Rabbit anti-Human CD86 mAb (Catalog Number: A21941) encodes a type I membrane protein that is a member of the immunoglobulin superfamily.

Store
SKU: A21941 Categories: ,
Clear
View cart
Order Offline:
Phone: 1-617-401-8149
Fax: 1-617-606-5019
Email: message@sydlabs.com
Catalog No. A21941
Product NameABflo® 647 Rabbit anti-Human CD86 mAb (A21941)
Supplier Name ABclonal, Inc.
Brand Name Abclonal
Synonyms B70; B7-2; B7.2; LAB72; CD28LG2
Gene Name CD86
Protein Name CD86
Uniprot/Swissprot ID P42081
Gene ID 942
Clonality Monoclonal
Source/Host Rabbit
Reactivity Human
Conjugate ABflo® 647. Ex:656nm. Em:670nm.
Note Products will be shipped from the warehouse in Massachusetts. Promotion is running from time to time. Welcome to send a request for quote to message@sydlabs.com.
Order Offline Syd Labs, Inc. 4 Avenue E, Hopkinton, MA 01748 USA. Phone: 1-617-401-8149 Fax: 1-617-606-5019 Email: message@sydlabs.com

Description

A21941: ABflo® 647 Rabbit anti-Human CD86 mAb

This gene encodes a type I membrane protein that is a member of the immunoglobulin superfamily. This protein is expressed by antigen-presenting cells, and it is the ligand for two proteins at the cell surface of T cells, CD28 antigen and cytotoxic T-lymphocyte-associated protein 4. Binding of this protein with CD28 antigen is a costimulatory signal for activation of the T-cell. Binding of this protein with cytotoxic T-lymphocyte-associated protein 4 negatively regulates T-cell activation and diminishes the immune response. Alternative splicing results in several transcript variants encoding different isoforms.

Immunogen Information about ABflo® 647 Rabbit anti-Human CD86 mAb (A21941)

Immunogen:Recombinant fusion protein containing a sequence corresponding to amino acids 20-241 of human CD86 (NP_787058.5).
Sequence:LSGAAPLKIQAYFNETADLPCQFANSQNQSLSELVVFWQDQENLVLNEVYLGKEKFDSVHSKYMGRTSFDSDSWTLRLHNLQIKDKGLYQCIIHHKKPTGMIRIHQMNSELSVLANFSQPEIVPISNITENVYINLTCSSIHGYPEPKKMSVLLRTKNSTIEYDGVMQKSQDNVTELYDVSISLSVSFPDVTSNMTIFCILETDKTRLLSSPFSIELEDPQP
Gene ID:942
Swiss prot:P42081
Synonyms:B70; B7-2; B7.2; LAB72; CD28LG2
Calculated MW:38kDa
Observed MW:Refer to figures

Images of ABflo® 647 Rabbit anti-Human CD86 mAb (A21941)

Flow cytometry:1X10^6 K-562 cells (negative control, left) and Raji cells (right) were surface-stained with ABflo® 647 Rabbit anti-Human CD86 mAb(A21941, 5 μl/Test, orange line) or ABflo® 647 Rabbit IgG isotype control (A22070, 5 μl/Test, blue line). Non-fluorescently stained cells were used as blank control (red line).

Please remember our product information: ABflo® 647 Rabbit anti-Human CD86 mAb (Catalog Number: A21941) Abclonal