ABflo® 647 Rabbit anti-Human CD68 mAb (A22515)

ABflo® 647 Rabbit anti-Human CD68 mAb (A22515)

ABflo® 647 Rabbit anti-Human CD68 mAb (A22515)

$218.00$568.00

In stock

$218.00$568.00

Abclonal ABflo® 647 Rabbit anti-Human CD68 mAb (Catalog Number: A22515) encodes a 110-kD transmembrane glycoprotein that is highly expressed by human monocytes and tissue macrophages.

Store
SKU: A22515
Clear
View cart
Catalog No. A22515
Product NameABflo® 647 Rabbit anti-Human CD68 mAb (A22515)
Supplier Name ABclonal, Inc.
Brand Name Abclonal
Synonyms GP110; LAMP4; SCARD1
Gene Name CD68
Protein Name CD68
Uniprot/Swissprot ID P34810
Entrez GeneID 968
Clonality Monoclonal
Source/Host Rabbit
Applications FC(Intra)
Reactivity Human
Conjugate ABflo® 647. Ex:656nm. Em:670nm.
Note Products will be shipped from the warehouse in Massachusetts. Promotion is running from time to time. Welcome to send a request for quote to message@sydlabs.com.
Order Offline Syd Labs, Inc. 4 Avenue E, Hopkinton, MA 01748 USA. Phone: 1-617-401-8149 Fax: 1-617-606-5019 Email: message@sydlabs.com

Description

A22515: ABflo® 647 Rabbit anti-Human CD68 mAb

This gene encodes a 110-kD transmembrane glycoprotein that is highly expressed by human monocytes and tissue macrophages. It is a member of the lysosomal/endosomal-associated membrane glycoprotein (LAMP) family. The protein primarily localizes to lysosomes and endosomes with a smaller fraction circulating to the cell surface. It is a type I integral membrane protein with a heavily glycosylated extracellular domain and binds to tissue- and organ-specific lectins or selectins. The protein is also a member of the scavenger receptor family. Scavenger receptors typically function to clear cellular debris, promote phagocytosis, and mediate the recruitment and activation of macrophages. Alternative splicing results in multiple transcripts encoding different isoforms.

Immunogen Information about ABflo® 647 Rabbit anti-Human CD68 mAb (A22515)

Immunogen:Recombinant fusion protein containing a sequence corresponding to amino acids 22-319 of human CD68 (NP_001242.2).
Sequence:NDCPHKKSATLLPSFTVTPTVTESTGTTSHRTTKSHKTTTHRTTTTGTTSHGPTTATHNPTTTSHGNVTVHPTSNSTATSQGPSTATHSPATTSHGNATVHPTSNSTATSPGFTSSAHPEPPPPSPSPSPTSKETIGDYTWTNGSQPCVHLQAQIQIRVMYTTQGGGEAWGISVLNPNKTKVQGSCEGAHPHLLLSFPYGHLSFGFMQDLQQKVVYLSYMAVEYNVSFPHAAQWTFSAQNASLRDLQAPLGQSFSCSNSSIILSPAVHLDLLSLRLQAAQLPHTGVFGQSFSCPSDRS
Gene ID:968
Swiss prot:P34810
Synonyms:GP110; LAMP4; SCARD1
Calculated MW:37kDa
Observed MW:

Images of ABflo® 647 Rabbit anti-Human CD68 mAb (A22515)

Flow cytometry:1X10^6 MOLT-4 cells (Low Expression, left) and A-431 cells (right) were intracellularly-stained with ABflo® 647 Rabbit anti-Human CD68 mAb(A22515, 5 μl/Test, orange line) or ABflo® 647 Rabbit IgG isotype control (A22070, 5 μl/Test, blue line). Non-fluorescently stained cells were used as blank control (red line).

Flow cytometry:1X10^6 A431 cells were intracellularly-stained with ABflo® 647 Rabbit IgG isotype control (A22070, 5 μl/Test, left) or ABflo® 647 Rabbit anti-Human CD68 mAb(A22515, 5 μl/Test, right).

Flow cytometry:1X10^6 MOLT-4 cells(Low Expression) were intracellularly-stained with ABflo® 647 Rabbit IgG isotype control (A22070, 5 μl/Test, left) or ABflo® 647 Rabbit anti-Human CD68 mAb(A22515, 5 μl/Test, right).

Flow cytometry:1X10^6 Human PBMC were intracellularly-stained with ABflo® 647 Rabbit anti-Human CD68 mAb(A22515, 5 μl/Test, orange line) or ABflo® 647 Rabbit IgG isotype control (A22069, 5 μl/Test, blue line).Non-fluorescently stained Human PBMC was used as blank control (red line).

Flow cytometry:1X10^6 Human PBMC cells were intracellularly-stained with ABflo® 647 Rabbit IgG isotype control (A22070, 5 μl/Test, left) or ABflo® 647 Rabbit anti-Human CD68 mAb(A22515, 5 μl/Test, right).

Please remember our product information: ABflo® 647 Rabbit anti-Human CD68 mAb (Catalog Number: A22515) Abclonal

Additional information

Ship from Country

USA

Size

100 μg, 25 μg, 50 μg

No more offers for this product!