ABflo® 647 Rabbit anti-Human CD59 mAb (A22589)
$218.00 – $568.00
Abclonal ABflo® 647 Rabbit anti-Human CD59 mAb (Catalog Number: A22589) encodes a cell surface glycoprotein that regulates complement-mediated cell lysis, and it is involved in lymphocyte signal transduction.
- Details & Specifications
- References
- More Offers
| Catalog No. | A22589 |
|---|---|
| Product Name | ABflo® 647 Rabbit anti-Human CD59 mAb (A22589) |
| Supplier Name | ABclonal, Inc. |
| Brand Name | Abclonal |
| Synonyms | 1F5; EJ16; EJ30; EL32; G344; MIN1; MIN2; MIN3; MIRL; HRF20; MACIF; MEM43; MIC11; MSK21; 16.3A5; HRF-20; MAC-IP; p18-20 |
| Gene Name | CD59 |
| Protein Name | CD59 |
| Uniprot/Swissprot ID | P13987 |
| Gene ID | 966 |
| Clonality | Monoclonal |
| Source/Host | Rabbit |
| Reactivity | Human |
| Conjugate | ABflo® 647. Ex:656nm. Em:670nm. |
| Note | Products will be shipped from the warehouse in Massachusetts. Promotion is running from time to time. Welcome to send a request for quote to message@sydlabs.com. |
| Order Offline | Syd Labs, Inc. 4 Avenue E, Hopkinton, MA 01748 USA. Phone: 1-617-401-8149 Fax: 1-617-606-5019 Email: message@sydlabs.com |
Description
A22589: ABflo® 647 Rabbit anti-Human CD59 mAb
This gene encodes a cell surface glycoprotein that regulates complement-mediated cell lysis, and it is involved in lymphocyte signal transduction. This protein is a potent inhibitor of the complement membrane attack complex, whereby it binds complement C8 and/or C9 during the assembly of this complex, thereby inhibiting the incorporation of multiple copies of C9 into the complex, which is necessary for osmolytic pore formation. This protein also plays a role in signal transduction pathways in the activation of T cells. Mutations in this gene cause CD59 deficiency, a disease resulting in hemolytic anemia and thrombosis, and which causes cerebral infarction. Multiple alternatively spliced transcript variants, which encode the same protein, have been identified for this gene.
Immunogen Information about ABflo® 647 Rabbit anti-Human CD59 mAb (A22589)
Immunogen:Recombinant fusion protein containing a sequence corresponding to amino acids 26-101 of human CD59 (NP_000602.1).
Sequence:LQCYNCPNPTADCKTAVNCSSDFDACLITKAGLQVYNKCWKFEHCNFNDVTTRLRENELTYYCCKKDLCNFNEQLE
Gene ID:966
Swiss prot:P13987
Synonyms:1F5; EJ16; EJ30; EL32; G344; MIN1; MIN2; MIN3; MIRL; HRF20; MACIF; MEM43; MIC11; MSK21; 16.3A5; HRF-20; MAC-IP; p18-20
Calculated MW:14kDa
Observed MW:
Images of ABflo® 647 Rabbit anti-Human CD59 mAb (A22589)

Flow cytometry:1X10^6 U937 cells (Low Expression, Left) and Jurkat cells (Right) were surface-stained with ABflo® 647 Rabbit anti-Human CD59 mAb(A22589, 5 μl/Test, orange line) or ABflo® 647 Rabbit IgG isotype control (A22070, 5 μl/Test, blue line). Non-fluorescently stained cells were used as blank control (red line).

Flow cytometry:1X10^6 Jurkat cells were surface-stained with ABflo® 647 Rabbit IgG isotype control (A22070, 5 μl/Test, left) or ABflo® 647 Rabbit anti-Human CD59 mAb(A22589, 5 μl/Test, right).

Flow cytometry:1X10^6 Human PBMC were surface-stained with ABflo® 647 Rabbit anti-Human CD59 mAb(A22589, 5 μl/Test, orange line) or ABflo® 647 Rabbit IgG isotype control (A22070, 5 μl/Test, blue line). Non-fluorescently stained cells were used as blank control (red line).

Flow cytometry:1X10^6 Human PBMC were surface-stained with ABflo® 647 Rabbit IgG isotype control (A22070, 5 μl/Test, left) or ABflo® 647 Rabbit anti-Human CD59 mAb(A22589, 5 μl/Test, right).
Please remember our product information: ABflo® 647 Rabbit anti-Human CD59 mAb (Catalog Number: A22589) Abclonal







