ABflo® 647 Rabbit anti-Human CD51 mAb (A22299)
$290.00 – $768.00
Abclonal ABflo® 647 Rabbit anti-Human CD51 mAb (Catalog Number: A22299) belongs to the integrin alpha chain family. Integrins are heterodimeric integral membrane proteins composed of an alpha subunit and a beta subunit that function in cell surface adhesion and signaling.
- Details & Specifications
- References
- More Offers
| Catalog No. | A22299 |
|---|---|
| Product Name | ABflo® 647 Rabbit anti-Human CD51 mAb (A22299) |
| Supplier Name | ABclonal, Inc. |
| Brand Name | Abclonal |
| Synonyms | CD51; MSK8; VNRA; VTNR |
| Gene Name | ITGAV |
| Protein Name | ITGAV |
| Uniprot/Swissprot ID | P06756 |
| Gene ID | 3685 |
| Clonality | Monoclonal |
| Source/Host | Rabbit |
| Reactivity | Human |
| Conjugate | ABflo® 647. Ex:656nm. Em:670nm. |
| Note | Products will be shipped from the warehouse in Massachusetts. Promotion is running from time to time. Welcome to send a request for quote to message@sydlabs.com. |
| Order Offline | Syd Labs, Inc. 4 Avenue E, Hopkinton, MA 01748 USA. Phone: 1-617-401-8149 Fax: 1-617-606-5019 Email: message@sydlabs.com |
Description
A22299: ABflo® 647 Rabbit anti-Human CD51 mAb
The product of this gene belongs to the integrin alpha chain family. Integrins are heterodimeric integral membrane proteins composed of an alpha subunit and a beta subunit that function in cell surface adhesion and signaling. The encoded preproprotein is proteolytically processed to generate light and heavy chains that comprise the alpha V subunit. This subunit associates with beta 1, beta 3, beta 5, beta 6 and beta 8 subunits. The heterodimer consisting of alpha V and beta 3 subunits is also known as the vitronectin receptor. This integrin may regulate angiogenesis and cancer progression. Alternative splicing results in multiple transcript variants. Note that the integrin alpha 5 and integrin alpha V subunits are encoded by distinct genes.
Immunogen Information about ABflo® 647 Rabbit anti-Human CD51 mAb (A22299)
Immunogen:A synthetic peptide corresponding to a sequence within amino acids 949-1048 of human CD51 (NP_002201.2).
Sequence:SLKSSASFNVIEFPYKNLPIEDITNSTLVTTNVTWGIQPAPMPVPVWVIILAVLAGLLLLAVLVFVMYRMGFFKRVRPPQEEQEREQLQPHENGEGNSET
Gene ID:3685
Swiss prot:P06756
Synonyms:CD51; MSK8; VNRA; VTNR
Calculated MW:116kDa
Observed MW:
Images of ABflo® 647 Rabbit anti-Human CD51 mAb (A22299)

Flow cytometry:1X10^6 MOLT-4 cells (Low Expression, left) and BeWo cells (right) were intracellularly-stained with ABflo® 647 Rabbit anti-Human CD51 mAb(A22299, 5 μl/Test, orange line) or ABflo® 647 Rabbit IgG isotype control (A22070, 5 μl/Test, blue line). Non-fluorescently stained cells were used as blank control (red line).

Flow cytometry:1X10^6 BeWo cells were intracellularly-stained with ABflo® 647 Rabbit IgG isotype control (A22070, 5 μl/Test, left) or ABflo® 647 Rabbit anti-Human CD51 mAb(A22299, 5 μl/Test, right).

Flow cytometry:1X10^6 MOLT-4 cells were intracellularly-stained with ABflo® 647 Rabbit IgG isotype control (A22070, 5 μl/Test, left) or ABflo® 647 Rabbit anti-Human CD51 mAb(A22299, 5 μl/Test, right).
Please remember our product information: ABflo® 647 Rabbit anti-Human CD51 mAb (Catalog Number: A22299) Abclonal





