ABflo® 647 Rabbit anti-Human CD225/IFITM1 mAb (A22311)
$218.00 – $568.00
Abclonal ABflo® 647 Rabbit anti-Human CD225/IFITM1 mAb (Catalog Number: A22311) Interferon-induced transmembrane (IFITM) proteins are a family of interferon induced antiviral proteins. The family contains five members, including IFITM1, IFITM2 and IFITM3 that belong to the CD225 superfamily.
- Details & Specifications
- References
| Catalog No. | A22311 |
|---|---|
| Product Name | ABflo® 647 Rabbit anti-Human CD225/IFITM1 mAb (A22311) |
| Supplier Name | ABclonal, Inc. |
| Brand Name | Abclonal |
| Synonyms | 9-27; CD225; IFI17; LEU13; DSPA2a |
| Gene Name | IFITM1 |
| Protein Name | IFITM1 |
| Uniprot/Swissprot ID | P13164 |
| Gene ID | 8519 |
| Clonality | Monoclonal |
| Source/Host | Rabbit |
| Reactivity | Human |
| Conjugate | ABflo® 647. Ex:656nm. Em:670nm. |
| Note | Products will be shipped from the warehouse in Massachusetts. Promotion is running from time to time. Welcome to send a request for quote to message@sydlabs.com. |
| Order Offline | Syd Labs, Inc. 4 Avenue E, Hopkinton, MA 01748 USA. Phone: 1-617-401-8149 Fax: 1-617-606-5019 Email: message@sydlabs.com |
Description
A22311: ABflo® 647 Rabbit anti-Human CD225/IFITM1 mAb
Interferon-induced transmembrane (IFITM) proteins are a family of interferon induced antiviral proteins. The family contains five members, including IFITM1, IFITM2 and IFITM3 that belong to the CD225 superfamily. The protein encoded by this gene restricts cellular entry by diverse viral pathogens, such as influenza A virus, Ebola virus and Sars-CoV-2.
Immunogen Information about ABflo® 647 Rabbit anti-Human CD225/IFITM1 mAb (A22311)
Immunogen:Recombinant fusion protein containing a sequence within amino acids 1-80 of human CD225/IFITM1 (NP_003632.4).
Sequence:MHKEEHEVAVLGPPPSTILPRSTVINIHSETSVPDHVVWSLFNTLFLNWCCLGFIAFAYSVKSRDRKMVGDVTGAQAYAS
Gene ID:8519
Swiss prot:P13164
Synonyms:9-27; CD225; IFI17; LEU13; DSPA2a
Calculated MW:14kDa
Observed MW:
Images of ABflo® 647 Rabbit anti-Human CD225/IFITM1 mAb (A22311)

Flow cytometry: 1X10^6 U-251MG cells (Low Expression, left) and K-562 cells (right) were intracellularly-stained with ABflo® 647 Rabbit anti-Human CD225/IFITM1 mAb (A22311, 2 μg/mL, orange line) or ABflo® 647 Rabbit IgG isotype control (A22070, 2 μg/mL, blue line). Non-fluorescently stained was used as blank control (red line).

Flow cytometry: 1X10^6 K-562 cells were intracellularly-stained with ABflo® 647 Rabbit IgG isotype control (A22070, 5 μl/Test, left) or ABflo® 647 Rabbit anti-Human CD225/IFITM1 mAb (A22311, 5 μl/Test, right).

Flow cytometry: 1X10^6 U-251 MG cells (Low Expression) were intracellularly-stained with ABflo® 647 Rabbit IgG isotype control (A22070, 5 μl/Test, left) or ABflo® 647 Rabbit anti-Human CD225/IFITM1 mAb (A22311, 5 μl/Test, right).
Please remember our product information: ABflo® 647 Rabbit anti-Human CD225/IFITM1 mAb (Catalog Number: A22311) Abclonal




