ABflo® 647 Rabbit anti-Human CD225/IFITM1 mAb (A22311)

ABflo® 647 Rabbit anti-Human CD225/IFITM1 mAb (A22311)

ABflo® 647 Rabbit anti-Human CD225/IFITM1 mAb (A22311)

$218.00$568.00

In stock

$218.00$568.00

Abclonal ABflo® 647 Rabbit anti-Human CD225/IFITM1 mAb (Catalog Number: A22311) Interferon-induced transmembrane (IFITM) proteins are a family of interferon induced antiviral proteins. The family contains five members, including IFITM1, IFITM2 and IFITM3 that belong to the CD225 superfamily.

Store
SKU: A22311 Categories: ,
Clear
View cart
Order Offline:
Phone: 1-617-401-8149
Fax: 1-617-606-5019
Email: message@sydlabs.com
Catalog No. A22311
Product NameABflo® 647 Rabbit anti-Human CD225/IFITM1 mAb (A22311)
Supplier Name ABclonal, Inc.
Brand Name Abclonal
Synonyms 9-27; CD225; IFI17; LEU13; DSPA2a
Gene Name IFITM1
Protein Name IFITM1
Uniprot/Swissprot ID P13164
Gene ID 8519
Clonality Monoclonal
Source/Host Rabbit
Reactivity Human
Conjugate ABflo® 647. Ex:656nm. Em:670nm.
Note Products will be shipped from the warehouse in Massachusetts. Promotion is running from time to time. Welcome to send a request for quote to message@sydlabs.com.
Order Offline Syd Labs, Inc. 4 Avenue E, Hopkinton, MA 01748 USA. Phone: 1-617-401-8149 Fax: 1-617-606-5019 Email: message@sydlabs.com

Description

A22311: ABflo® 647 Rabbit anti-Human CD225/IFITM1 mAb

Interferon-induced transmembrane (IFITM) proteins are a family of interferon induced antiviral proteins. The family contains five members, including IFITM1, IFITM2 and IFITM3 that belong to the CD225 superfamily. The protein encoded by this gene restricts cellular entry by diverse viral pathogens, such as influenza A virus, Ebola virus and Sars-CoV-2.

Immunogen Information about ABflo® 647 Rabbit anti-Human CD225/IFITM1 mAb (A22311)

Immunogen:Recombinant fusion protein containing a sequence within amino acids 1-80 of human CD225/IFITM1 (NP_003632.4).
Sequence:MHKEEHEVAVLGPPPSTILPRSTVINIHSETSVPDHVVWSLFNTLFLNWCCLGFIAFAYSVKSRDRKMVGDVTGAQAYAS
Gene ID:8519
Swiss prot:P13164
Synonyms:9-27; CD225; IFI17; LEU13; DSPA2a
Calculated MW:14kDa
Observed MW:

Images of ABflo® 647 Rabbit anti-Human CD225/IFITM1 mAb (A22311)

Flow cytometry: 1X10^6 U-251MG cells (Low Expression, left) and K-562 cells (right) were intracellularly-stained with ABflo® 647 Rabbit anti-Human CD225/IFITM1 mAb (A22311, 2 μg/mL, orange line) or ABflo® 647 Rabbit IgG isotype control (A22070, 2 μg/mL, blue line). Non-fluorescently stained was used as blank control (red line).

Flow cytometry: 1X10^6 K-562 cells were intracellularly-stained with ABflo® 647 Rabbit IgG isotype control (A22070, 5 μl/Test, left) or ABflo® 647 Rabbit anti-Human CD225/IFITM1 mAb (A22311, 5 μl/Test, right).

Flow cytometry: 1X10^6 U-251 MG cells (Low Expression) were intracellularly-stained with ABflo® 647 Rabbit IgG isotype control (A22070, 5 μl/Test, left) or ABflo® 647 Rabbit anti-Human CD225/IFITM1 mAb (A22311, 5 μl/Test, right).

Please remember our product information: ABflo® 647 Rabbit anti-Human CD225/IFITM1 mAb (Catalog Number: A22311) Abclonal

No more offers for this product!