ABflo® 647 Rabbit anti-Human CD120b/TNFRSF1B mAb (A23222)
$290.00 – $768.00
Abclonal ABflo® 647 Rabbit anti-Human CD120b/TNFRSF1B mAb (Catalog Number: A23222) encoded by this gene is a member of the TNF-receptor superfamily.
- Product Details
- Description
- Additional information
- More Offers
| Catalog No. | A23222 |
|---|---|
| Product Name | ABflo® 647 Rabbit anti-Human CD120b/TNFRSF1B mAb (A23222) |
| Supplier Name | ABclonal, Inc. |
| Brand Name | Abclonal |
| Synonyms | p75; TBPII; TNFBR; TNFR2; CD120b; TNFR1B; TNFR80; TNF-R75; p75TNFR; TNF-R-II |
| Gene Name | TNFRSF1B |
| Protein Name | TNFRSF1B |
| Uniprot/Swissprot ID | P20333 |
| Entrez GeneID | 7133 |
| Clonality | Monoclonal |
| Source/Host | Rabbit |
| Applications | FC |
| Reactivity | Human |
| Conjugate | ABflo® 647. Ex:656nm. Em:670nm. |
| Note | Products will be shipped from the warehouse in Massachusetts. Promotion is running from time to time. Welcome to send a request for quote to message@sydlabs.com. |
| Order Offline | Syd Labs, Inc. 4 Avenue E, Hopkinton, MA 01748 USA. Phone: 1-617-401-8149 Fax: 1-617-606-5019 Email: message@sydlabs.com |
Description
A23222: ABflo® 647 Rabbit anti-Human CD120b/TNFRSF1B mAb
The protein encoded by this gene is a member of the TNF-receptor superfamily. This protein and TNF-receptor 1 form a heterocomplex that mediates the recruitment of two anti-apoptotic proteins, c-IAP1 and c-IAP2, which possess E3 ubiquitin ligase activity. The function of IAPs in TNF-receptor signalling is unknown, however, c-IAP1 is thought to potentiate TNF-induced apoptosis by the ubiquitination and degradation of TNF-receptor-associated factor 2, which mediates anti-apoptotic signals. Knockout studies in mice also suggest a role of this protein in protecting neurons from apoptosis by stimulating antioxidative pathways.
Immunogen Information about ABflo® 647 Rabbit anti-Human CD120b/TNFRSF1B mAb (A23222)
Immunogen：Recombinant fusion protein containing a sequence corresponding to amino acids 23-257 of human CD120b/TNFRSF1B (NP_001057.1).
Sequence：LPAQVAFTPYAPEPGSTCRLREYYDQTAQMCCSKCSPGQHAKVFCTKTSDTVCDSCEDSTYTQLWNWVPECLSCGSRCSSDQVETQACTREQNRICTCRPGWYCALSKQEGCRLCAPLRKCRPGFGVARPGTETSDVVCKPCAPGTFSNTTSSTDICRPHQICNVVAIPGNASMDAVCTSTSPTRSMAPGAVHLPQPVSTRSQHTQPTPEPSTAPSTSFLLPMGPSPPAEGSTGD
Gene ID：7133
Swiss prot：P20333
Synonyms：p75; TBPII; TNFBR; TNFR2; CD120b; TNFR1B; TNFR80; TNF-R75; p75TNFR; TNF-R-II
Calculated MW：28kDa/48kDa
Observed MW：
Images of ABflo® 647 Rabbit anti-Human CD120b/TNFRSF1B mAb (A23222)
Flow cytometry:1X10^6 293F cells (negative control, Left) and HEL cells (right) were surface-stained with ABflo® 647 Rabbit anti-Human CD120b/TNFRSF1B mAb(A23222, 5 μl/Test, orange line) or ABflo® 647 Rabbit IgG isotype control (A22070, 5 μl/Test, blue line). Non-fluorescently stained cells were used as blank control (red line).
Flow cytometry:1X10^6 HEL cells were surface-stained with ABflo® 647 Rabbit IgG isotype control (A22070, 5 μl/Test, left) or ABflo® 647 Rabbit anti-Human CD120b/TNFRSF1B mAb(A23222, 5 μl/Test, right).
Flow cytometry:1X10^6 Human PBMC were surface-stained with ABflo® 647 Rabbit anti-Human CD120b/TNFRSF1B mAb(A23222, 5 μl/Test, orange line) or ABflo® 647 Rabbit IgG isotype control (A22070, 5 μl/Test, blue line). Non-fluorescently stained cells were used as blank control (red line).
Flow cytometry:1X10^6 Human PBMC were surface-stained with ABflo® 647 Rabbit IgG isotype control (A22070, 5 μl/Test, left) or ABflo® 647 Rabbit anti-Human CD120b/TNFRSF1B mAb(A23222, 5 μl/Test, right).
Please remember our product information: ABflo® 647 Rabbit anti-Human CD120b/TNFRSF1B mAb (Catalog Number: A23222) Abclonal
Additional information
| Ship from Country | USA |
|---|---|
| Size | 100 μg, 25 μg, 50 μg |