ABflo® 647 Rabbit anti-Cat CD3G mAb (A22491)

ABflo® 647 Rabbit anti-Cat CD3G mAb (A22491)

ABflo® 647 Rabbit anti-Cat CD3G mAb (A22491)

$290.00$768.00

In stock

$290.00$768.00

Abclonal ABflo® 647 Rabbit anti-Cat CD3G mAb (Catalog Number: A22491) encoded by this gene is the CD3-gamma polypeptide, which together with CD3-epsilon, -delta and -zeta, and the T-cell receptor alpha/beta and gamma/delta heterodimers, forms the T-cell receptor-CD3 complex.

Store
SKU: A22491 Categories: ,
Clear
View cart
Order Offline:
Phone: 1-617-401-8149
Fax: 1-617-606-5019
Email: message@sydlabs.com
Catalog No. A22491
Product NameABflo® 647 Rabbit anti-Cat CD3G mAb (A22491)
Supplier Name ABclonal, Inc.
Brand Name Abclonal
Synonyms T3G; IMD17; CD3GAMMA; CD3-GAMMA
Gene Name CD3G
Protein Name CD3G
Gene ID 101089292
Clonality Monoclonal
Source/Host Rabbit
Reactivity Cat
Conjugate ABflo® 647. Ex:656nm. Em:670nm.
Note Products will be shipped from the warehouse in Massachusetts. Promotion is running from time to time. Welcome to send a request for quote to message@sydlabs.com.
Order Offline Syd Labs, Inc. 4 Avenue E, Hopkinton, MA 01748 USA. Phone: 1-617-401-8149 Fax: 1-617-606-5019 Email: message@sydlabs.com

Description

A22491: ABflo® 647 Rabbit anti-Cat CD3G mAb

The protein encoded by this gene is the CD3-gamma polypeptide, which together with CD3-epsilon, -delta and -zeta, and the T-cell receptor alpha/beta and gamma/delta heterodimers, forms the T-cell receptor-CD3 complex. This complex plays an important role in coupling antigen recognition to several intracellular signal-transduction pathways. The genes encoding the epsilon, gamma and delta polypeptides are located in the same cluster on chromosome 11. Defects in this gene are associated with T cell immunodeficiency.

Immunogen Information about ABflo® 647 Rabbit anti-Cat CD3G mAb (A22491)

Immunogen:Recombinant fusion protein containing a sequence corresponding to amino acids 23-116 of cat CD3G (XP_003992456.3).
Sequence:QSKQEIPVVRVNSDREDGSVLLTCESPDKDVKWFQDGKEMTPHKKNKNIQNLGSSIKDPRGIYWCQGSKNRSRTLQVYFRMCQNCIELSRATVS
Gene ID:101089292
Swiss prot:
Synonyms:T3G; IMD17; CD3GAMMA; CD3-GAMMA
Calculated MW:20kDa
Observed MW:

Images of ABflo® 647 Rabbit anti-Cat CD3G mAb (A22491)

Flow cytometry: 1X10^6 293F cells (negative control, left) and 293F (Transfection, right) cells were surface-stained with ABflo® 647 Rabbit anti-Cat CD3G mAb (A22491, 2 μg/mL, orange line) or ABflo® 647 Rabbit IgG isotype control (A22070, 2 μg/mL, blue line). Non-fluorescently stained cells was used as blank control (red line).

Flow cytometry: 1X10^6 293F (Transfection) cells were surface-stained with ABflo® 647 Rabbit IgG isotype control (A22070, 5 μl/Test, left) or ABflo® 647 Rabbit anti-Cat CD3G mAb (A22491, 5 μl/Test, right).

Please remember our product information: ABflo® 647 Rabbit anti-Cat CD3G mAb (Catalog Number: A22491) Abclonal