ABflo® 594 Rabbit anti-Human CD150/SLAM mAb (A23363)

ABflo® 594 Rabbit anti-Human CD150/SLAM mAb (A23363)

ABflo® 594 Rabbit anti-Human CD150/SLAM mAb (A23363)

$290.00$768.00

In stock

$290.00$768.00

Abclonal ABflo® 594 Rabbit anti-Human CD150/SLAM mAb (Catalog Number: A23363) Enables SH2 domain binding activity and identical protein binding activity.

Store
SKU: A23363 Categories: ,
Clear
View cart
Order Offline:
Phone: 1-617-401-8149
Fax: 1-617-606-5019
Email: message@sydlabs.com
Catalog No. A23363
Product NameABflo® 594 Rabbit anti-Human CD150/SLAM mAb (A23363)
Supplier Name ABclonal, Inc.
Brand Name Abclonal
Synonyms SLAM; CD150; CDw150
Gene Name SLAMF1
Protein Name SLAMF1
Uniprot/Swissprot ID Q13291
Gene ID 6504
Clonality Monoclonal
Source/Host Rabbit
Reactivity Human
Conjugate ABflo® 594. Ex:594nm. Em:619nm.
Note Products will be shipped from the warehouse in Massachusetts. Promotion is running from time to time. Welcome to send a request for quote to message@sydlabs.com.
Order Offline Syd Labs, Inc. 4 Avenue E, Hopkinton, MA 01748 USA. Phone: 1-617-401-8149 Fax: 1-617-606-5019 Email: message@sydlabs.com

Description

A23363: ABflo® 594 Rabbit anti-Human CD150/SLAM mAb

Enables SH2 domain binding activity and identical protein binding activity. Involved in several processes, including negative regulation of CD40 signaling pathway; negative regulation of cytokine production; and positive regulation of MAPK cascade. Located in extracellular exosome.

Immunogen Information about ABflo® 594 Rabbit anti-Human CD150/SLAM mAb (A23363)

Immunogen:Recombinant fusion protein containing a sequence corresponding to amino acids 21-237 of human CD150 (NP_003028.1).
Sequence:ASYGTGGRMMNCPKILRQLGSKVLLPLTYERINKSMNKSIHIVVTMAKSLENSVENKIVSLDPSEAGPPRYLGDRYKFYLENLTLGIRESRKEDEGWYLMTLEKNVSVQRFCLQLRLYEQVSTPEIKVLNKTQENGTCTLILGCTVEKGDHVAYSWSEKAGTHPLNPANSSHLLSLTLGPQHADNIYICTVSNPISNNSQTFSPWPGCRTDPSETKP
Gene ID:6504
Swiss prot:Q13291
Synonyms:SLAM; CD150; CDw150
Calculated MW:37kDa
Observed MW:Refer to figures

Images of ABflo® 594 Rabbit anti-Human CD150/SLAM mAb (A23363)

Flow cytometry:1X10^6 293F cells(negative control, left) and 293F(Transfection, right) cells were surface-stained with ABflo® 594 Rabbit anti-Human CD150/SLAM mAb(A23363, 5 μl/Test, orange line) or ABflo® 594 Rabbit IgG isotype control (A23821, 5 μl/Test, blue line).Non-fluorescently stained cells was used as blank control (red line).

Flow cytometry:1X10^6 293F(Transfection) cells were surface-stained with ABflo® 594 Rabbit IgG isotype control (A23821, 5 μl/Test, left) or ABflo® 594 Rabbit anti-Human CD150/SLAM mAb(A23363, 5 μl/Test, right).

Please remember our product information: ABflo® 594 Rabbit anti-Human CD150/SLAM mAb (Catalog Number: A23363) Abclonal