ABflo® 594 Rabbit anti-Human CD150/SLAM mAb (A23363)
$290.00 – $768.00
Abclonal ABflo® 594 Rabbit anti-Human CD150/SLAM mAb (Catalog Number: A23363) Enables SH2 domain binding activity and identical protein binding activity.
- Details & Specifications
- References
| Catalog No. | A23363 |
|---|---|
| Product Name | ABflo® 594 Rabbit anti-Human CD150/SLAM mAb (A23363) |
| Supplier Name | ABclonal, Inc. |
| Brand Name | Abclonal |
| Synonyms | SLAM; CD150; CDw150 |
| Gene Name | SLAMF1 |
| Protein Name | SLAMF1 |
| Uniprot/Swissprot ID | Q13291 |
| Gene ID | 6504 |
| Clonality | Monoclonal |
| Source/Host | Rabbit |
| Reactivity | Human |
| Conjugate | ABflo® 594. Ex:594nm. Em:619nm. |
| Note | Products will be shipped from the warehouse in Massachusetts. Promotion is running from time to time. Welcome to send a request for quote to message@sydlabs.com. |
| Order Offline | Syd Labs, Inc. 4 Avenue E, Hopkinton, MA 01748 USA. Phone: 1-617-401-8149 Fax: 1-617-606-5019 Email: message@sydlabs.com |
Description
A23363: ABflo® 594 Rabbit anti-Human CD150/SLAM mAb
Enables SH2 domain binding activity and identical protein binding activity. Involved in several processes, including negative regulation of CD40 signaling pathway; negative regulation of cytokine production; and positive regulation of MAPK cascade. Located in extracellular exosome.
Immunogen Information about ABflo® 594 Rabbit anti-Human CD150/SLAM mAb (A23363)
Immunogen:Recombinant fusion protein containing a sequence corresponding to amino acids 21-237 of human CD150 (NP_003028.1).
Sequence:ASYGTGGRMMNCPKILRQLGSKVLLPLTYERINKSMNKSIHIVVTMAKSLENSVENKIVSLDPSEAGPPRYLGDRYKFYLENLTLGIRESRKEDEGWYLMTLEKNVSVQRFCLQLRLYEQVSTPEIKVLNKTQENGTCTLILGCTVEKGDHVAYSWSEKAGTHPLNPANSSHLLSLTLGPQHADNIYICTVSNPISNNSQTFSPWPGCRTDPSETKP
Gene ID:6504
Swiss prot:Q13291
Synonyms:SLAM; CD150; CDw150
Calculated MW:37kDa
Observed MW:Refer to figures
Images of ABflo® 594 Rabbit anti-Human CD150/SLAM mAb (A23363)

Flow cytometry:1X10^6 293F cells(negative control, left) and 293F(Transfection, right) cells were surface-stained with ABflo® 594 Rabbit anti-Human CD150/SLAM mAb(A23363, 5 μl/Test, orange line) or ABflo® 594 Rabbit IgG isotype control (A23821, 5 μl/Test, blue line).Non-fluorescently stained cells was used as blank control (red line).

Flow cytometry:1X10^6 293F(Transfection) cells were surface-stained with ABflo® 594 Rabbit IgG isotype control (A23821, 5 μl/Test, left) or ABflo® 594 Rabbit anti-Human CD150/SLAM mAb(A23363, 5 μl/Test, right).
Please remember our product information: ABflo® 594 Rabbit anti-Human CD150/SLAM mAb (Catalog Number: A23363) Abclonal



