ABflo® 488 Rabbit anti-Human IgG (Fc) mAb (A22504)
$290.00 – $768.00
Abclonal ABflo® 488 Rabbit anti-Human IgG (Fc) mAb (Catalog Number: A22504) Predicted to enable antigen binding activity and immunoglobulin receptor binding activity.
- Details & Specifications
- References
- More Offers
| Catalog No. | A22504 |
|---|---|
| Product Name | ABflo® 488 Rabbit anti-Human IgG (Fc) mAb (A22504) |
| Supplier Name | ABclonal, Inc. |
| Brand Name | Abclonal |
| Gene Name | IGHG1 |
| Protein Name | IGHG1 |
| Uniprot/Swissprot ID | P01857 |
| Gene ID | 3500 |
| Clonality | Monoclonal |
| Source/Host | Rabbit |
| Reactivity | Human |
| Conjugate | ABflo® 488. Ex:491nm. Em:516nm. |
| Note | Products will be shipped from the warehouse in Massachusetts. Promotion is running from time to time. Welcome to send a request for quote to message@sydlabs.com. |
| Order Offline | Syd Labs, Inc. 4 Avenue E, Hopkinton, MA 01748 USA. Phone: 1-617-401-8149 Fax: 1-617-606-5019 Email: message@sydlabs.com |
Description
A22504: ABflo® 488 Rabbit anti-Human IgG (Fc) mAb
Predicted to enable antigen binding activity and immunoglobulin receptor binding activity. Predicted to be involved in several processes, including activation of immune response; defense response to other organism; and phagocytosis. Predicted to act upstream of or within several processes, including immunoglobulin mediated immune response; positive regulation of hypersensitivity; and positive regulation of phagocytosis. Located in extracellular space.
Immunogen Information about ABflo® 488 Rabbit anti-Human IgG (Fc) mAb (A22504)
Immunogen:Recombinant fusion protein containing a sequence corresponding to amino acids 100-330 of human IgG1 (Fc) (P01857).
Sequence:PKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
Gene ID:3500
Swiss prot:P01857
Synonyms:
Calculated MW:36kDa
Observed MW:Refer to figures
Images of ABflo® 488 Rabbit anti-Human IgG (Fc) mAb (A22504)

Flow cytometry:1X10^6 293F cells (negative control, left) and 293F(Transfection, right) cells were intracellularly-stained with ABflo® 488 Rabbit anti-Human IgG (Fc) mAb(A22504, 5 μl/Test, orange line) or ABflo® 488 Rabbit IgG isotype control (A22069, 5 μl/Test, blue line). Non-fluorescently stained cells were used as blank control (red line).

Flow cytometry:1X10^6 293F(Transfection) cells were intracellularly-stained with ABflo® 488 Rabbit IgG isotype control (A22069, 5 μl/Test, left) or ABflo® 488 Rabbit anti-Human IgG (Fc) mAb(A22504, 5 μl/Test, right).

Flow cytometry:1X10^6 Human PBMC cells were intracellularly-stained with ABflo® 488 Rabbit IgG isotype control (A22069, 5 μl/Test) or ABflo® 488 Rabbit anti-Human IgG (Fc) mAb(A22504, 5 μl/Test).The cells were simultaneously stained with ABflo® 647 Rabbit anti-Human/Monkey CD19 mAb(A23009, 5 μl/Test).
Please remember our product information: ABflo® 488 Rabbit anti-Human IgG (Fc) mAb (Catalog Number: A22504) Abclonal





