ABflo® 488 Rabbit anti-Human ICAM-1/CD54 mAb (A22312)
$290.00 – $768.00
Abclonal ABflo® 488 Rabbit anti-Human ICAM-1/CD54 mAb (Catalog Number: A22312) is a cell surface glycoprotein that belongs to the immunoglobulin superfamily (IgSF) of adhesion molecules.
- Details & Specifications
- References
- More Offers
| Catalog No. | A22312 |
|---|---|
| Product Name | ABflo® 488 Rabbit anti-Human ICAM-1/CD54 mAb (A22312) |
| Supplier Name | ABclonal, Inc. |
| Brand Name | Abclonal |
| Synonyms | BB2; CD54; P3.58 |
| Gene Name | ICAM1 |
| Protein Name | ICAM1 |
| Uniprot/Swissprot ID | P05362 |
| Gene ID | 3383 |
| Clonality | Monoclonal |
| Source/Host | Rabbit |
| Reactivity | Human |
| Conjugate | ABflo® 488. Ex:491nm. Em:516nm. |
| Note | Products will be shipped from the warehouse in Massachusetts. Promotion is running from time to time. Welcome to send a request for quote to message@sydlabs.com. |
| Order Offline | Syd Labs, Inc. 4 Avenue E, Hopkinton, MA 01748 USA. Phone: 1-617-401-8149 Fax: 1-617-606-5019 Email: message@sydlabs.com |
Description
A22312: ABflo® 488 Rabbit anti-Human ICAM-1/CD54 mAb
Intercellular cell adhesion molecule-1 (CD54 or ICAM-1) is a cell surface glycoprotein that belongs to the immunoglobulin superfamily (IgSF) of adhesion molecules. CD54 is expressed at low levels in diverse cell types, and is induced by cytokines (TNF-α, interleukin-1) and bacterial lipopolysaccharide . Apical localization of CD54 on endothelial cells (or basolateral localization on epithelial cells) is a prerequisite for leukocyte trafficking through the endothelial (or epithelial) barrier . Apical expression of CD54 on epithelial cells mediates pathogen invasion as well as host defense, a pattern also observed in tumors . CD54 also functions as a co-stimulator on antigen presenting cells, binding to its receptor LFA-1 (leukocyte function-associated antigen-1) on the surface of T cells during antigen presentation . Cross-linking of CD54 or binding to its ligand triggers activation of Src family kinases and the Rho/ROCK pathway . Phosphorylation on Tyr485 of CD54 is required for its association with SHP-2. SHP-2 seems essential for CD54-induced Src activation.
Immunogen Information about ABflo® 488 Rabbit anti-Human ICAM-1/CD54 mAb (A22312)
Immunogen：Recombinant fusion protein containing a sequence corresponding to amino acids 28-480 of human ICAM-1/CD54 (NP_000192.2).
Sequence：QTSVSPSKVILPRGGSVLVTCSTSCDQPKLLGIETPLPKKELLLPGNNRKVYELSNVQEDSQPMCYSNCPDGQSTAKTFLTVYWTPERVELAPLPSWQPVGKNLTLRCQVEGGAPRANLTVVLLRGEKELKREPAVGEPAEVTTTVLVRRDHHGANFSCRTELDLRPQGLELFENTSAPYQLQTFVLPATPPQLVSPRVLEVDTQGTVVCSLDGLFPVSEAQVHLALGDQRLNPTVTYGNDSFSAKASVSVTAEDEGTQRLTCAVILGNQSQETLQTVTIYSFPAPNVILTKPEVSEGTEVTVKCEAHPRAKVTLNGVPAQPLGPRAQLLLKATPEDNGRSFSCSATLEVAGQLIHKNQTRELRVLYGPRLDERDCPGNWTWPENSQQTPMCQAWGNPLPELKCLKDGTFPLPIGESVTVTRDLEGTYLCRARSTQGEVTRKVTVNVLSPRYE
Gene ID：3383
Swiss prot：P05362
Synonyms：BB2; CD54; P3.58
Calculated MW：58kDa
Observed MW：
Images of ABflo® 488 Rabbit anti-Human ICAM-1/CD54 mAb (A22312)
Flow cytometry: 1X10^6 293F cells (negative control, left) and Raji cells (right) were surface-stained with ABflo® 488 Rabbit anti-Human ICAM-1/CD54 mAb (A22312, 2 μg/mL, orange line) or ABflo® 488 Rabbit IgG isotype control (A22069, 2 μg/mL, blue line). Non-fluorescently stained cells was used as blank control (red line).
Flow cytometry: 1X10^6 Raji cells were surface-stained with ABflo® 488 Rabbit IgG isotype control (A22069, 5 μl/Test, left) or ABflo® 488 Rabbit anti-Human ICAM-1/CD54 mAb (A22312, 5 μl/Test, right).
Please remember our product information: ABflo® 488 Rabbit anti-Human ICAM-1/CD54 mAb (Catalog Number: A22312) Abclonal
