ABflo® 488 Rabbit anti-Human ErbB3/HER3 mAb (A22506)
$218.00 – $568.00
Abclonal ABflo® 488 Rabbit anti-Human ErbB3/HER3 mAb (Catalog Number: A22506) encodes a member of the epidermal growth factor receptor (EGFR) family of receptor tyrosine kinases.
- Details & Specifications
- References
| Catalog No. | A22506 |
|---|---|
| Product Name | ABflo® 488 Rabbit anti-Human ErbB3/HER3 mAb (A22506) |
| Supplier Name | ABclonal, Inc. |
| Brand Name | Abclonal |
| Synonyms | HER3; FERLK; LCCS2; VSCN1; ErbB-3; c-erbB3; erbB3-S; MDA-BF-1; c-erbB-3; p180-ErbB3; p45-sErbB3; p85-sErbB3 |
| Gene Name | ERBB3 |
| Protein Name | ERBB3 |
| Uniprot/Swissprot ID | P21860 |
| Gene ID | 2065 |
| Clonality | Monoclonal |
| Source/Host | Rabbit |
| Reactivity | Human |
| Conjugate | ABflo® 488. Ex:491nm. Em:516nm. |
| Note | Products will be shipped from the warehouse in Massachusetts. Promotion is running from time to time. Welcome to send a request for quote to message@sydlabs.com. |
| Order Offline | Syd Labs, Inc. 4 Avenue E, Hopkinton, MA 01748 USA. Phone: 1-617-401-8149 Fax: 1-617-606-5019 Email: message@sydlabs.com |
Description
A22506: ABflo® 488 Rabbit anti-Human ErbB3/HER3 mAb
This gene encodes a member of the epidermal growth factor receptor (EGFR) family of receptor tyrosine kinases. This membrane-bound protein has a neuregulin binding domain but not an active kinase domain. It therefore can bind this ligand but not convey the signal into the cell through protein phosphorylation. However, it does form heterodimers with other EGF receptor family members which do have kinase activity. Heterodimerization leads to the activation of pathways which lead to cell proliferation or differentiation. Amplification of this gene and/or overexpression of its protein have been reported in numerous cancers, including prostate, bladder, and breast tumors. Alternate transcriptional splice variants encoding different isoforms have been characterized. One isoform lacks the intermembrane region and is secreted outside the cell. This form acts to modulate the activity of the membrane-bound form. Additional splice variants have also been reported, but they have not been thoroughly characterized.
Immunogen Information about ABflo® 488 Rabbit anti-Human ErbB3/HER3 mAb (A22506)
Immunogen:Recombinant fusion protein containing a sequence corresponding to amino acids 20-643 of human ErbB3/HER3 (NP_001973.2).
Sequence:SEVGNSQAVCPGTLNGLSVTGDAENQYQTLYKLYERCEVVMGNLEIVLTGHNADLSFLQWIREVTGYVLVAMNEFSTLPLPNLRVVRGTQVYDGKFAIFVMLNYNTNSSHALRQLRLTQLTEILSGGVYIEKNDKLCHMDTIDWRDIVRDRDAEIVVKDNGRSCPPCHEVCKGRCWGPGSEDCQTLTKTICAPQCNGHCFGPNPNQCCHDECAGGCSGPQDTDCFACRHFNDSGACVPRCPQPLVYNKLTFQLEPNPHTKYQYGGVCVASCPHNFVVDQTSCVRACPPDKMEVDKNGLKMCEPCGGLCPKACEGTGSGSRFQTVDSSNIDGFVNCTKILGNLDFLITGLNGDPWHKIPALDPEKLNVFRTVREITGYLNIQSWPPHMHNFSVFSNLTTIGGRSLYNRGFSLLIMKNLNVTSLGFRSLKEISAGRIYISANRQLCYHHSLNWTKVLRGPTEERLDIKHNRPRRDCVAEGKVCDPLCSSGGCWGPGPGQCLSCRNYSRGGVCVTHCNFLNGEPREFAHEAECFSCHPECQPMEGTATCNGSGSDTCAQCAHFRDGPHCVSSCPHGVLGAKGPIYKYPDVQNECRPCHENCTQGCKGPELQDCLGQTLVLIGKTHLT
Gene ID:2065
Swiss prot:P21860
Synonyms:HER3; FERLK; LCCS2; VSCN1; ErbB-3; c-erbB3; erbB3-S; MDA-BF-1; c-erbB-3; p180-ErbB3; p45-sErbB3; p85-sErbB3
Calculated MW:148kDa
Observed MW:Refer to figures
Images of ABflo® 488 Rabbit anti-Human ErbB3/HER3 mAb (A22506)

Flow cytometry:1X10^6 HEL cells (negative control, left) and MCF7 cells (right) were surface-stained with ABflo® 488 Rabbit anti-Human ErbB3/HER3 mAb(A22506, 5 μl/Test, orange line) or ABflo® 488 Rabbit IgG isotype control (A22069, 5 μl/Test, blue line). Non-fluorescently stained cells were used as blank control (red line).

Flow cytometry:1X10^6 MCF7 cells were surface-stained with ABflo® 488 Rabbit IgG isotype control (A22069, 5 μl/Test, left) or ABflo® 488 Rabbit anti-Human ErbB3/HER3 mAb(A22506, 5 μl/Test, right).
Please remember our product information: ABflo® 488 Rabbit anti-Human ErbB3/HER3 mAb (Catalog Number: A22506) Abclonal



