ABflo® 488 Rabbit anti-Human CD90/Thy1 mAb (A22510)
$218.00 – $568.00
Abclonal ABflo® 488 Rabbit anti-Human CD90/Thy1 mAb (Catalog Number: A22510) encodes a cell surface glycoprotein and member of the immunoglobulin superfamily of proteins.
- Product Details
- Description
- Additional information
- More Offers
| Catalog No. | A22510 |
|---|---|
| Product Name | ABflo® 488 Rabbit anti-Human CD90/Thy1 mAb (A22510) |
| Supplier Name | ABclonal, Inc. |
| Brand Name | Abclonal |
| Synonyms | CD90; CDw90 |
| Gene Name | THY1 |
| Protein Name | THY1 |
| Uniprot/Swissprot ID | P04216 |
| Entrez GeneID | 7070 |
| Clonality | Monoclonal |
| Source/Host | Rabbit |
| Applications | FC |
| Reactivity | Human |
| Conjugate | ABflo® 488. Ex:491nm. Em:516nm. |
| Note | Products will be shipped from the warehouse in Massachusetts. Promotion is running from time to time. Welcome to send a request for quote to message@sydlabs.com. |
| Order Offline | Syd Labs, Inc. 4 Avenue E, Hopkinton, MA 01748 USA. Phone: 1-617-401-8149 Fax: 1-617-606-5019 Email: message@sydlabs.com |
Description
A22510: ABflo® 488 Rabbit anti-Human CD90/Thy1 mAb
This gene encodes a cell surface glycoprotein and member of the immunoglobulin superfamily of proteins. The encoded protein is involved in cell adhesion and cell communication in numerous cell types, but particularly in cells of the immune and nervous systems. The encoded protein is widely used as a marker for hematopoietic stem cells. This gene may function as a tumor suppressor in nasopharyngeal carcinoma. Alternative splicing results in multiple transcript variants.
Immunogen Information about ABflo® 488 Rabbit anti-Human CD90/Thy1 mAb (A22510)
Immunogen：Recombinant fusion protein containing a sequence corresponding to amino acids 20-130 of human CD90/Thy1 (NP_006279.2).
Sequence：QKVTSLTACLVDQSLRLDCRHENTSSSPIQYEFSLTRETKKHVLFGTVGVPEHTYRSRTNFTSKYNMKVLYLSAFTSKDEGTYTCALHHSGHSPPISSQNVTVLRDKLVKC
Gene ID：7070
Swiss prot：P04216
Synonyms：CD90; CDw90
Calculated MW：18kDa
Observed MW：
Images of ABflo® 488 Rabbit anti-Human CD90/Thy1 mAb (A22510)
Flow cytometry:1X10^6 K-562 cells (negative control, left) and U-251MG cells (right) were surface-stained with ABflo® 488 Rabbit anti-Human CD90/Thy1 mAb(A22510, 5 μl/Test, orange line) or ABflo® 488 Rabbit IgG isotype control (A22069, 5 μl/Test, blue line). Non-fluorescently stained cells were used as blank control (red line).
Flow cytometry:1X10^6 U-251MG cells were surface-stained with ABflo® 488 Rabbit IgG isotype control (A22069, 5 μl/Test, left) or ABflo® 488 Rabbit anti-Human CD90 mAb(A22510, 5 μl/Test, right).
Please remember our product information: ABflo® 488 Rabbit anti-Human CD90/Thy1 mAb (Catalog Number: A22510) Abclonal
Additional information
| Ship from Country | USA |
|---|---|
| Size | 100 μg, 25 μg, 50 μg |