ABflo® 488 Rabbit anti-Human CD7 mAb (A22193)

ABflo® 488 Rabbit anti-Human CD7 mAb (A22193)

ABflo® 488 Rabbit anti-Human CD7 mAb (A22193)

$290.00$768.00

In stock

$290.00$768.00

Abclonal ABflo® 488 Rabbit anti-Human CD7 mAb (Catalog Number: A22193) encodes a transmembrane protein which is a member of the immunoglobulin superfamily.

Store
SKU: A22193 Categories: ,
Clear
View cart
Order Offline:
Phone: 1-617-401-8149
Fax: 1-617-606-5019
Email: message@sydlabs.com
Catalog No. A22193
Product NameABflo® 488 Rabbit anti-Human CD7 mAb (A22193)
Supplier Name ABclonal, Inc.
Brand Name Abclonal
Synonyms GP40; TP41; Tp40; LEU-9
Gene Name CD7
Protein Name CD7
Uniprot/Swissprot ID P09564
Gene ID 924
Clonality Monoclonal
Source/Host Rabbit
Reactivity Human
Conjugate ABflo® 488. Ex:491nm. Em:516nm.
Note Products will be shipped from the warehouse in Massachusetts. Promotion is running from time to time. Welcome to send a request for quote to message@sydlabs.com.
Order Offline Syd Labs, Inc. 4 Avenue E, Hopkinton, MA 01748 USA. Phone: 1-617-401-8149 Fax: 1-617-606-5019 Email: message@sydlabs.com

Description

A22193: ABflo® 488 Rabbit anti-Human CD7 mAb

This gene encodes a transmembrane protein which is a member of the immunoglobulin superfamily. This protein is found on thymocytes and mature T cells. It plays an essential role in T-cell interactions and also in T-cell/B-cell interaction during early lymphoid development.

Immunogen Information about ABflo® 488 Rabbit anti-Human CD7 mAb (A22193)

Immunogen:Recombinant fusion protein containing a sequence corresponding to amino acids 26-180 of human CD7 (NP_006128.1).
Sequence:AQEVQQSPHCTTVPVGASVNITCSTSGGLRGIYLRQLGPQPQDIIYYEDGVVPTTDRRFRGRIDFSGSQDNLTITMHRLQLSDTGTYTCQAITEVNVYGSGTLVLVTEEQSQGWHRCSDAPPRASALPAPPTGSALPDPQTASALPDPPAASALP
Gene ID:924
Swiss prot:P09564
Synonyms:GP40; TP41; Tp40; LEU-9
Calculated MW:25kDa
Observed MW:

Images of ABflo® 488 Rabbit anti-Human CD7 mAb (A22193)

Flow cytometry:1X10^6 A549 cells (negative control, left) and MOLT-4 cells (right) were surface-stained with ABflo® 488 Rabbit anti-Human CD7 mAb(A22193, 5 μl/Test, orange line) or ABflo® 488 Rabbit IgG isotype control (A22069, 5 μl/Test, blue line). Non-fluorescently stained cells were used as blank control (red line).

Flow cytometry:1X10^6 Human PBMC were surface-stained with ABflo® 488 Rabbit anti-Human CD7 mAb(A22193, 5 μl/Test, orange line) or ABflo® 488 Rabbit IgG isotype control (A22069, 5 μl/Test, blue line).Non-fluorescently stained Human PBMC was used as blank control (red line).

Flow cytometry:1X10^6 Human PBMC cells were surface-stained with ABflo® 488 Rabbit IgG isotype control (A22069, 5 μl/Test, left) or ABflo® 488 Rabbit anti-Human CD7 mAb(A22193, 5 μl/Test, right).

Please remember our product information: ABflo® 488 Rabbit anti-Human CD7 mAb (Catalog Number: A22193) Abclonal

No more offers for this product!