ABflo® 488 Rabbit anti-Human CD51 mAb (A22298)

ABflo® 488 Rabbit anti-Human CD51 mAb (A22298)

ABflo® 488 Rabbit anti-Human CD51 mAb (A22298)

$290.00$768.00

In stock

$290.00$768.00

Abclonal ABflo® 488 Rabbit anti-Human CD51 mAb (Catalog Number: A22298) belongs to the integrin alpha chain family. Integrins are heterodimeric integral membrane proteins composed of an alpha subunit and a beta subunit that function in cell surface adhesion and signaling.

Store
SKU: A22298 Categories: ,
Clear
View cart
Order Offline:
Phone: 1-617-401-8149
Fax: 1-617-606-5019
Email: message@sydlabs.com
Catalog No. A22298
Product NameABflo® 488 Rabbit anti-Human CD51 mAb (A22298)
Supplier Name ABclonal, Inc.
Brand Name Abclonal
Synonyms CD51; MSK8; VNRA; VTNR
Gene Name ITGAV
Protein Name ITGAV
Uniprot/Swissprot ID P06756
Gene ID 3685
Clonality Monoclonal
Source/Host Rabbit
Reactivity Human
Conjugate ABflo® 488. Ex:491nm. Em:516nm.
Note Products will be shipped from the warehouse in Massachusetts. Promotion is running from time to time. Welcome to send a request for quote to message@sydlabs.com.
Order Offline Syd Labs, Inc. 4 Avenue E, Hopkinton, MA 01748 USA. Phone: 1-617-401-8149 Fax: 1-617-606-5019 Email: message@sydlabs.com

Description

A22298: ABflo® 488 Rabbit anti-Human CD51 mAb

The product of this gene belongs to the integrin alpha chain family. Integrins are heterodimeric integral membrane proteins composed of an alpha subunit and a beta subunit that function in cell surface adhesion and signaling. The encoded preproprotein is proteolytically processed to generate light and heavy chains that comprise the alpha V subunit. This subunit associates with beta 1, beta 3, beta 5, beta 6 and beta 8 subunits. The heterodimer consisting of alpha V and beta 3 subunits is also known as the vitronectin receptor. This integrin may regulate angiogenesis and cancer progression. Alternative splicing results in multiple transcript variants. Note that the integrin alpha 5 and integrin alpha V subunits are encoded by distinct genes.

Immunogen Information about ABflo® 488 Rabbit anti-Human CD51 mAb (A22298)

Immunogen:A synthetic peptide corresponding to a sequence within amino acids 949-1048 of human CD51 (NP_002201.2).
Sequence:SLKSSASFNVIEFPYKNLPIEDITNSTLVTTNVTWGIQPAPMPVPVWVIILAVLAGLLLLAVLVFVMYRMGFFKRVRPPQEEQEREQLQPHENGEGNSET
Gene ID:3685
Swiss prot:P06756
Synonyms:CD51; MSK8; VNRA; VTNR
Calculated MW:116kDa
Observed MW:

Images of ABflo® 488 Rabbit anti-Human CD51 mAb (A22298)

Flow cytometry:1X10^6 MOLT-4 cells (Low Expression, left) and BeWo cells (right) were intracellularly-stained with ABflo® 488 Rabbit anti-Human CD51 mAb(A22298, 5 μl/Test, orange line) or ABflo® 488 Rabbit IgG isotype control (A22069, 5 μl/Test, blue line). Non-fluorescently stained cells were used as blank control (red line).

Flow cytometry:1X10^6 BeWo cells were intracellularly-stained with ABflo® 488 Rabbit IgG isotype control (A22069, 5 μl/Test, left) or ABflo® 488 Rabbit anti-Human CD51 mAb(A22298, 5 μl/Test, right).

Flow cytometry:1X10^6 MOLT-4 cells were intracellularly-stained with ABflo® 488 Rabbit IgG isotype control (A22069, 5 μl/Test, left) or ABflo® 488 Rabbit anti-Human CD51 mAb(A22298, 5 μl/Test, right).

Please remember our product information: ABflo® 488 Rabbit anti-Human CD51 mAb (Catalog Number: A22298) Abclonal

No more offers for this product!