ABflo® 488 Rabbit anti-Human CD5 mAb (A22185)

ABflo® 488 Rabbit anti-Human CD5 mAb (A22185)

ABflo® 488 Rabbit anti-Human CD5 mAb (A22185)

$290.00$768.00

In stock

$290.00$768.00

Abclonal ABflo® 488 Rabbit anti-Human CD5 mAb (Catalog Number: A22185) encodes a member of the scavenger receptor cysteine-rich (SRCR) superfamily. Members of this family are secreted or membrane-anchored proteins mainly found in cells associated with the immune system.

Store
SKU: A22185 Categories: ,
Clear
View cart
Order Offline:
Phone: 1-617-401-8149
Fax: 1-617-606-5019
Email: message@sydlabs.com
Catalog No. A22185
Product NameABflo® 488 Rabbit anti-Human CD5 mAb (A22185)
Supplier Name ABclonal, Inc.
Brand Name Abclonal
Synonyms T1; LEU1
Gene Name CD5
Protein Name CD5
Uniprot/Swissprot ID P06127
Gene ID 921
Clonality Monoclonal
Source/Host Rabbit
Reactivity Human
Conjugate ABflo® 488. Ex:491nm. Em:516nm.
Note Products will be shipped from the warehouse in Massachusetts. Promotion is running from time to time. Welcome to send a request for quote to message@sydlabs.com.
Order Offline Syd Labs, Inc. 4 Avenue E, Hopkinton, MA 01748 USA. Phone: 1-617-401-8149 Fax: 1-617-606-5019 Email: message@sydlabs.com

Description

A22185: ABflo® 488 Rabbit anti-Human CD5 mAb

This gene encodes a member of the scavenger receptor cysteine-rich (SRCR) superfamily. Members of this family are secreted or membrane-anchored proteins mainly found in cells associated with the immune system. This protein is a type-I transmembrane glycoprotein found on the surface of thymocytes, T lymphocytes and a subset of B lymphocytes. The encoded protein contains three SRCR domains and may act as a receptor to regulate T-cell proliferation. Alternative splicing results in multiple transcript variants encoding different isoforms.

Immunogen Information about ABflo® 488 Rabbit anti-Human CD5 mAb (A22185)

Immunogen:Recombinant fusion protein containing a sequence corresponding to amino acids 25-371 of human CD5 (NP_055022.2).
Sequence:RLSWYDPDFQARLTRSNSKCQGQLEVYLKDGWHMVCSQSWGRSSKQWEDPSQASKVCQRLNCGVPLSLGPFLVTYTPQSSIICYGQLGSFSNCSHSRNDMCHSLGLTCLEPQKTTPPTTRPPPTTTPEPTAPPRLQLVAQSGGQHCAGVVEFYSGSLGGTISYEAQDKTQDLENFLCNNLQCGSFLKHLPETEAGRAQDPGEPREHQPLPIQWKIQNSSCTSLEHCFRKIKPQKSGRVLALLCSGFQPKVQSRLVGGSSICEGTVEVRQGAQWAALCDSSSARSSLRWEEVCREQQCGSVNSYRVLDAGDPTSRGLFCPHQKLSQCHELWERNSYCKKVFVTCQDPN
Gene ID:921
Swiss prot:P06127
Synonyms:T1; LEU1
Calculated MW:55kDa
Observed MW:

Images of ABflo® 488 Rabbit anti-Human CD5 mAb (A22185)

Flow cytometry:1X10^6 K562 cells (negative control, left) and MOLT-4 cells (right) were surface-stained with ABflo® 488 Rabbit anti-Human CD5 mAb(A22185, 5 μl/Test, orange line) or ABflo® 488 Rabbit IgG isotype control (A22069, 5 μl/Test, blue line). Non-fluorescently stained cells were used as blank control (red line).

Flow cytometry:1X10^6 Human PBMC were surface-stained with ABflo® 488 Rabbit anti-Human CD5 mAb(A22185, 5 μl/Test, orange line) or ABflo® 488 Rabbit IgG isotype control (A22069, 5 μl/Test, blue line).Non-fluorescently stained Human PBMC was used as blank control (red line).

Flow cytometry:1X10^6 Human PBMC cells were surface-stained with ABflo® 488 Rabbit IgG isotype control (A22069, 5 μl/Test, left) or ABflo® 488 Rabbit anti-Human CD5 mAb(A22185, 5 μl/Test, right).

Please remember our product information: ABflo® 488 Rabbit anti-Human CD5 mAb (Catalog Number: A22185) Abclonal

No more offers for this product!