ABflo® 488 Rabbit anti-Human CD48 mAb (A21937)

ABflo® 488 Rabbit anti-Human CD48 mAb (A21937)

ABflo® 488 Rabbit anti-Human CD48 mAb (A21937)

$218.00$568.00

In stock

$218.00$568.00

Abclonal ABflo® 488 Rabbit anti-Human CD48 mAb (Catalog Number: A21937) encodes a member of the CD2 subfamily of immunoglobulin-like receptors which includes SLAM (signaling lymphocyte activation molecules) proteins.

Store
SKU: A21937 Categories: ,
Clear
View cart
Order Offline:
Phone: 1-617-401-8149
Fax: 1-617-606-5019
Email: message@sydlabs.com
Catalog No. A21937
Product NameABflo® 488 Rabbit anti-Human CD48 mAb (A21937)
Supplier Name ABclonal, Inc.
Brand Name Abclonal
Synonyms BCM1; BLAST; hCD48; mCD48; BLAST1; SLAMF2; MEM-102
Gene Name CD48
Protein Name CD48
Uniprot/Swissprot ID P09326
Gene ID 962
Clonality Monoclonal
Source/Host Rabbit
Reactivity Human
Conjugate ABflo® 488. Ex:491nm. Em:516nm.
Note Products will be shipped from the warehouse in Massachusetts. Promotion is running from time to time. Welcome to send a request for quote to message@sydlabs.com.
Order Offline Syd Labs, Inc. 4 Avenue E, Hopkinton, MA 01748 USA. Phone: 1-617-401-8149 Fax: 1-617-606-5019 Email: message@sydlabs.com

Description

A21937: ABflo® 488 Rabbit anti-Human CD48 mAb

This gene encodes a member of the CD2 subfamily of immunoglobulin-like receptors which includes SLAM (signaling lymphocyte activation molecules) proteins. The encoded protein is found on the surface of lymphocytes and other immune cells, dendritic cells and endothelial cells, and participates in activation and differentiation pathways in these cells. The encoded protein does not have a transmembrane domain, however, but is held at the cell surface by a GPI anchor via a C-terminal domain which maybe cleaved to yield a soluble form of the receptor. Multiple transcript variants encoding different isoforms have been found for this gene.

Immunogen Information about ABflo® 488 Rabbit anti-Human CD48 mAb (A21937)

Immunogen:Recombinant fusion protein containing a sequence corresponding to amino acids 27-220 of human CD48(NP_001769.2)
Sequence:QGHLVHMTVVSGSNVTLNISESLPENYKQLTWFYTFDQKIVEWDSRKSKYFESKFKGRVRLDPQSGALYISKVQKEDNSTYIMRVLKKTGNEQEWKIKLQVLDPVPKPVIKIEKIEDMDDNCYLKLSCVIPGESVNYTWYGDKRPFPKELQNSVLETTLMPHNYSRCYTCQVSNSVSSKNGTVCLSPPCTLARS
Gene ID:962
Swiss prot:P09326
Synonyms:BCM1; BLAST; hCD48; mCD48; BLAST1; SLAMF2; MEM-102
Calculated MW:28kDa
Observed MW:

Images of ABflo® 488 Rabbit anti-Human CD48 mAb (A21937)

Flow cytometry:1X10^6 K-562 cells (negative control, left) and Daudi cells (right) were surface-stained with ABflo® 488 Rabbit anti-Human CD48 mAb(A21937, 5 μl/Test, orange line) or ABflo® 488 Rabbit IgG isotype control (A22069, 5 μl/Test, blue line). Non-fluorescently stained cells were used as blank control (red line).

Flow cytometry:1X10^6 K-562 cells (negative control, left) and Human PBMC (right) were surface-stained with ABflo® 488 Rabbit anti-Human CD48 mAb(A21937, 5 μl/Test, orange line) or ABflo® 488 Rabbit IgG isotype control (A22069, 5 μl/Test, blue line). Non-fluorescently stained cells were used as blank control (red line).

Please remember our product information: ABflo® 488 Rabbit anti-Human CD48 mAb (Catalog Number: A21937) Abclonal