ABflo® 488 Rabbit anti-Human CD317/BST2 mAb (A22517)
$218.00 – $568.00
Abclonal ABflo® 488 Rabbit anti-Human CD317/BST2 mAb (Catalog Number: A22517) Bone marrow stromal cells are involved in the growth and development of B-cells.
- Product Details
- Description
- Additional information
- More Offers
| Catalog No. | A22517 |
|---|---|
| Product Name | ABflo® 488 Rabbit anti-Human CD317/BST2 mAb (A22517) |
| Supplier Name | ABclonal, Inc. |
| Brand Name | Abclonal |
| Synonyms | CD317; HM1.24; TETHERIN |
| Gene Name | BST2 |
| Protein Name | BST2 |
| Uniprot/Swissprot ID | Q10589 |
| Entrez GeneID | 684 |
| Clonality | Monoclonal |
| Source/Host | Rabbit |
| Applications | FC |
| Reactivity | Human |
| Conjugate | ABflo® 488. Ex:491nm. Em:516nm. |
| Note | Products will be shipped from the warehouse in Massachusetts. Promotion is running from time to time. Welcome to send a request for quote to message@sydlabs.com. |
| Order Offline | Syd Labs, Inc. 4 Avenue E, Hopkinton, MA 01748 USA. Phone: 1-617-401-8149 Fax: 1-617-606-5019 Email: message@sydlabs.com |
Description
A22517: ABflo® 488 Rabbit anti-Human CD317/BST2 mAb
Bone marrow stromal cells are involved in the growth and development of B-cells. The specific function of the protein encoded by the bone marrow stromal cell antigen 2 is undetermined; however, this protein may play a role in pre-B-cell growth and in rheumatoid arthritis.
Immunogen Information about ABflo® 488 Rabbit anti-Human CD317/BST2 mAb (A22517)
Immunogen：Recombinant fusion protein containing a sequence corresponding to amino acids 49-160 of human CD317/BST2 (NP_004326.1).
Sequence：NSEACRDGLRAVMECRNVTHLLQQELTEAQKGFQDVEAQAATCNHTVMALMASLDAEKAQGQKKVEELEGEITTLNHKLQDASAEVERLRRENQVLSVRIADKKYYPSSQDS
Gene ID：684
Swiss prot：Q10589
Synonyms：CD317; HM1.24; TETHERIN
Calculated MW：18kDa/19kDa
Observed MW：Refer to figures
Images of ABflo® 488 Rabbit anti-Human CD317/BST2 mAb (A22517)
Flow cytometry:1X10^6 A549 cells (negative control, left) and HeLa cells (right) were surface-stained with ABflo® 488 Rabbit anti-Human CD317/BST2 mAb(A22517, 5 μl/Test, orange line) or ABflo® 488 Rabbit IgG isotype control (A22069, 5 μl/Test, blue line). Non-fluorescently stained cells were used as blank control (red line).
Flow cytometry:1X10^6 Hela cells were surface-stained with ABflo® 488 Rabbit IgG isotype control (A22069, 5 μl/Test, left) or ABflo® 488 Rabbit anti-Human BST2 mAb(A22517, 5 μl/Test, right).
Please remember our product information: ABflo® 488 Rabbit anti-Human CD317/BST2 mAb (Catalog Number: A22517) Abclonal
Additional information
| Ship from Country | USA |
|---|---|
| Size | 100 μg, 25 μg, 50 μg |