ABflo® 488 Rabbit anti-Human CD30 mAb (A22214)
$218.00 – $568.00
Abclonal ABflo® 488 Rabbit anti-Human CD30 mAb (Catalog Number: A22214) encoded by this gene is a member of the TNF-receptor superfamily. This receptor is expressed by activated, but not by resting, T and B cells.
- Details & Specifications
- References
- More Offers
| Catalog No. | A22214 |
|---|---|
| Product Name | ABflo® 488 Rabbit anti-Human CD30 mAb (A22214) |
| Supplier Name | ABclonal, Inc. |
| Brand Name | Abclonal |
| Synonyms | CD30; Ki-1; D1S166E |
| Gene Name | TNFRSF8 |
| Protein Name | TNFRSF8 |
| Uniprot/Swissprot ID | P28908 |
| Gene ID | 943 |
| Clonality | Monoclonal |
| Source/Host | Rabbit |
| Reactivity | Human |
| Conjugate | ABflo® 488. Ex:491nm. Em:516nm. |
| Note | Products will be shipped from the warehouse in Massachusetts. Promotion is running from time to time. Welcome to send a request for quote to message@sydlabs.com. |
| Order Offline | Syd Labs, Inc. 4 Avenue E, Hopkinton, MA 01748 USA. Phone: 1-617-401-8149 Fax: 1-617-606-5019 Email: message@sydlabs.com |
Description
A22214: ABflo® 488 Rabbit anti-Human CD30 mAb
The protein encoded by this gene is a member of the TNF-receptor superfamily. This receptor is expressed by activated, but not by resting, T and B cells. TRAF2 and TRAF5 can interact with this receptor, and mediate the signal transduction that leads to the activation of NF-kappaB. This receptor is a positive regulator of apoptosis, and also has been shown to limit the proliferative potential of autoreactive CD8 effector T cells and protect the body against autoimmunity. Two alternatively spliced transcript variants of this gene encoding distinct isoforms have been reported.
Immunogen Information about ABflo® 488 Rabbit anti-Human CD30 mAb (A22214)
Immunogen：Recombinant fusion protein containing a sequence corresponding to amino acids 19-379 of human CD30 (NP_001234.3).
Sequence：FPQDRPFEDTCHGNPSHYYDKAVRRCCYRCPMGLFPTQQCPQRPTDCRKQCEPDYYLDEADRCTACVTCSRDDLVEKTPCAWNSSRVCECRPGMFCSTSAVNSCARCFFHSVCPAGMIVKFPGTAQKNTVCEPASPGVSPACASPENCKEPSSGTIPQAKPTPVSPATSSASTMPVRGGTRLAQEAASKLTRAPDSPSSVGRPSSDPGLSPTQPCPEGSGDCRKQCEPDYYLDEAGRCTACVSCSRDDLVEKTPCAWNSSRTCECRPGMICATSATNSCARCVPYPICAAETVTKPQDMAEKDTTFEAPPLGTQPDCNPTPENGEAPASTSPTQSLLVDSQASKTLPIPTSAPVALSSTGK
Gene ID：943
Swiss prot：P28908
Synonyms：CD30; Ki-1; D1S166E
Calculated MW：14kDa/50kDa/63kDa
Observed MW：
Images of ABflo® 488 Rabbit anti-Human CD30 mAb (A22214)
Flow cytometry:1X10^6 A549 cells (negative control, left) and K-562 cells (right) were surface-stained with ABflo® 488 Rabbit anti-Human CD30 mAb(A22214, 5 μl/Test, orange line) or ABflo® 488 Rabbit IgG isotype control (A22069, 5 μl/Test, blue line). Non-fluorescently stained cells were used as blank control (red line).
Please remember our product information: ABflo® 488 Rabbit anti-Human CD30 mAb (Catalog Number: A22214) Abclonal
