ABflo® 488 Rabbit anti-Human CD30 mAb (A22214)

ABflo® 488 Rabbit anti-Human CD30 mAb (A22214)

ABflo® 488 Rabbit anti-Human CD30 mAb (A22214)

$218.00$568.00

In stock

$218.00$568.00

Abclonal ABflo® 488 Rabbit anti-Human CD30 mAb (Catalog Number: A22214) encoded by this gene is a member of the TNF-receptor superfamily. This receptor is expressed by activated, but not by resting, T and B cells.

Store
SKU: A22214 Categories: ,
Clear
View cart
Order Offline:
Phone: 1-617-401-8149
Fax: 1-617-606-5019
Email: message@sydlabs.com
Catalog No. A22214
Product NameABflo® 488 Rabbit anti-Human CD30 mAb (A22214)
Supplier Name ABclonal, Inc.
Brand Name Abclonal
Synonyms CD30; Ki-1; D1S166E
Gene Name TNFRSF8
Protein Name TNFRSF8
Uniprot/Swissprot ID P28908
Gene ID 943
Clonality Monoclonal
Source/Host Rabbit
Reactivity Human
Conjugate ABflo® 488. Ex:491nm. Em:516nm.
Note Products will be shipped from the warehouse in Massachusetts. Promotion is running from time to time. Welcome to send a request for quote to message@sydlabs.com.
Order Offline Syd Labs, Inc. 4 Avenue E, Hopkinton, MA 01748 USA. Phone: 1-617-401-8149 Fax: 1-617-606-5019 Email: message@sydlabs.com

Description

A22214: ABflo® 488 Rabbit anti-Human CD30 mAb

The protein encoded by this gene is a member of the TNF-receptor superfamily. This receptor is expressed by activated, but not by resting, T and B cells. TRAF2 and TRAF5 can interact with this receptor, and mediate the signal transduction that leads to the activation of NF-kappaB. This receptor is a positive regulator of apoptosis, and also has been shown to limit the proliferative potential of autoreactive CD8 effector T cells and protect the body against autoimmunity. Two alternatively spliced transcript variants of this gene encoding distinct isoforms have been reported.

Immunogen Information about ABflo® 488 Rabbit anti-Human CD30 mAb (A22214)

Immunogen:Recombinant fusion protein containing a sequence corresponding to amino acids 19-379 of human CD30 (NP_001234.3).
Sequence:FPQDRPFEDTCHGNPSHYYDKAVRRCCYRCPMGLFPTQQCPQRPTDCRKQCEPDYYLDEADRCTACVTCSRDDLVEKTPCAWNSSRVCECRPGMFCSTSAVNSCARCFFHSVCPAGMIVKFPGTAQKNTVCEPASPGVSPACASPENCKEPSSGTIPQAKPTPVSPATSSASTMPVRGGTRLAQEAASKLTRAPDSPSSVGRPSSDPGLSPTQPCPEGSGDCRKQCEPDYYLDEAGRCTACVSCSRDDLVEKTPCAWNSSRTCECRPGMICATSATNSCARCVPYPICAAETVTKPQDMAEKDTTFEAPPLGTQPDCNPTPENGEAPASTSPTQSLLVDSQASKTLPIPTSAPVALSSTGK
Gene ID:943
Swiss prot:P28908
Synonyms:CD30; Ki-1; D1S166E
Calculated MW:14kDa/50kDa/63kDa
Observed MW:

Images of ABflo® 488 Rabbit anti-Human CD30 mAb (A22214)

Flow cytometry:1X10^6 A549 cells (negative control, left) and K-562 cells (right) were surface-stained with ABflo® 488 Rabbit anti-Human CD30 mAb(A22214, 5 μl/Test, orange line) or ABflo® 488 Rabbit IgG isotype control (A22069, 5 μl/Test, blue line). Non-fluorescently stained cells were used as blank control (red line).

Please remember our product information: ABflo® 488 Rabbit anti-Human CD30 mAb (Catalog Number: A22214) Abclonal

No more offers for this product!