ABflo® 488 Rabbit anti-Human CD215/IL-15R alpha mAb (A22582)

ABflo® 488 Rabbit anti-Human CD215/IL-15R alpha mAb (A22582)

ABflo® 488 Rabbit anti-Human CD215/IL-15R alpha mAb (A22582)

$290.00$768.00

In stock

$290.00$768.00

Abclonal ABflo® 488 Rabbit anti-Human CD215/IL-15R alpha mAb (Catalog Number: A22582) encodes a cytokine receptor that specifically binds interleukin 15 (IL15) with high affinity.

Store
SKU: A22582 Categories: ,
Clear
View cart
Order Offline:
Phone: 1-617-401-8149
Fax: 1-617-606-5019
Email: message@sydlabs.com
Catalog No. A22582
Product NameABflo® 488 Rabbit anti-Human CD215/IL-15R alpha mAb (A22582)
Supplier Name ABclonal, Inc.
Brand Name Abclonal
Synonyms CD215
Gene Name IL15RA
Protein Name IL15RA
Uniprot/Swissprot ID Q13261
Gene ID 3601
Clonality Monoclonal
Source/Host Rabbit
Reactivity Human
Conjugate ABflo® 488. Ex:491nm. Em:516nm.
Note Products will be shipped from the warehouse in Massachusetts. Promotion is running from time to time. Welcome to send a request for quote to message@sydlabs.com.
Order Offline Syd Labs, Inc. 4 Avenue E, Hopkinton, MA 01748 USA. Phone: 1-617-401-8149 Fax: 1-617-606-5019 Email: message@sydlabs.com

Description

A22582: ABflo® 488 Rabbit anti-Human CD215/IL-15R alpha mAb

This gene encodes a cytokine receptor that specifically binds interleukin 15 (IL15) with high affinity. The receptors of IL15 and IL2 share two subunits, IL2R beta and IL2R gamma. This forms the basis of many overlapping biological activities of IL15 and IL2. The protein encoded by this gene is structurally related to IL2R alpha, an additional IL2-specific alpha subunit necessary for high affinity IL2 binding. Unlike IL2RA, IL15RA is capable of binding IL15 with high affinity independent of other subunits, which suggests distinct roles between IL15 and IL2. This receptor is reported to enhance cell proliferation and expression of apoptosis inhibitor BCL2L1/BCL2-XL and BCL2. Multiple alternatively spliced transcript variants of this gene have been reported.

Immunogen Information about ABflo® 488 Rabbit anti-Human CD215/IL-15R alpha mAb (A22582)

Immunogen:Recombinant fusion protein containing a sequence corresponding to amino acids 31-205 of human CD215/IL-15R alpha (NP_002180.1).
Sequence:ITCPPPMSVEHADIWVKSYSLYSRERYICNSGFKRKAGTSSLTECVLNKATNVAHWTTPSLKCIRDPALVHQRPAPPSTVTTAGVTPQPESLSPSGKEPAASSPSSNNTAATTAAIVPGSQLMPSKSPSTGTTEISSHESSHGTPSQTTAKNWELTASASHQPPGVYPQGHSDTT
Gene ID:3601
Swiss prot:Q13261
Synonyms:CD215
Calculated MW:28kDa
Observed MW:

Images of ABflo® 488 Rabbit anti-Human CD215/IL-15R alpha mAb (A22582)

Flow cytometry:1X10^6 293F cells (negative control, left) and 293F(Transfection, right) cells were surface-stained with ABflo® 488 Rabbit anti-Human CD215/IL-15R mAb(A22582, 5 μl/Test, orange line) or ABflo® 488 Rabbit IgG isotype control (A22069, 5 μl/Test, blue line). Non-fluorescently stained cells were used as blank control (red line).

Please remember our product information: ABflo® 488 Rabbit anti-Human CD215/IL-15R alpha mAb (Catalog Number: A22582) Abclonal