ABflo® 488 Rabbit anti-Human CD162/PSGL-1 mAb (A22630)
$218.00 – $568.00
Abclonal ABflo® 488 Rabbit anti-Human CD162/PSGL-1 mAb (Catalog Number: A22630) encodes a glycoprotein that functions as a high affinity counter-receptor for the cell adhesion molecules P-, E- and L- selectin expressed on myeloid cells and stimulated T lymphocytes.
- Details & Specifications
- References
- More Offers
| Catalog No. | A22630 |
|---|---|
| Product Name | ABflo® 488 Rabbit anti-Human CD162/PSGL-1 mAb (A22630) |
| Supplier Name | ABclonal, Inc. |
| Brand Name | Abclonal |
| Synonyms | CLA; CD162; PSGL1; PSGL-1 |
| Gene Name | SELPLG |
| Protein Name | SELPLG |
| Uniprot/Swissprot ID | Q14242 |
| Gene ID | 6404 |
| Clonality | Monoclonal |
| Source/Host | Rabbit |
| Reactivity | Human |
| Conjugate | ABflo® 488. Ex:491nm. Em:516nm. |
| Note | Products will be shipped from the warehouse in Massachusetts. Promotion is running from time to time. Welcome to send a request for quote to message@sydlabs.com. |
| Order Offline | Syd Labs, Inc. 4 Avenue E, Hopkinton, MA 01748 USA. Phone: 1-617-401-8149 Fax: 1-617-606-5019 Email: message@sydlabs.com |
Description
A22630: ABflo® 488 Rabbit anti-Human CD162/PSGL-1 mAb
This gene encodes a glycoprotein that functions as a high affinity counter-receptor for the cell adhesion molecules P-, E- and L- selectin expressed on myeloid cells and stimulated T lymphocytes. As such, this protein plays a critical role in leukocyte trafficking during inflammation by tethering of leukocytes to activated platelets or endothelia expressing selectins. This protein requires two post-translational modifications, tyrosine sulfation and the addition of the sialyl Lewis x tetrasaccharide (sLex) to its O-linked glycans, for its high-affinity binding activity. Aberrant expression of this gene and polymorphisms in this gene are associated with defects in the innate and adaptive immune response. Alternate splicing results in multiple transcript variants.
Immunogen Information about ABflo® 488 Rabbit anti-Human CD162/PSGL-1 mAb (A22630)
Immunogen:Recombinant fusion protein containing a sequence corresponding to amino acids 42-295 of human CD162/PSGL-1 (NP_002997.2).
Sequence:QATEYEYLDYDFLPETEPPEMLRNSTDTTPLTGPGTPESTTVEPAARRSTGLDAGGAVTELTTELANMGNLSTDSAAMEIQTTQPAATEAQTTQPVPTEAQTTPLAATEAQTTRLTATEAQTTPLAATEAQTTPPAATEAQTTQPTGLEAQTTAPAAMEAQTTAPAAMEAQTTPPAAMEAQTTQTTAMEAQTTAPEATEAQTTQPTATEAQTTPLAAMEALSTEPSATEALSMEPTTKRGLFIPFSVSSVTHKG
Gene ID:6404
Swiss prot:Q14242
Synonyms:CLA; CD162; PSGL1; PSGL-1
Calculated MW:43kDa/44kDa
Observed MW:
Images of ABflo® 488 Rabbit anti-Human CD162/PSGL-1 mAb (A22630)

Flow cytometry:1X10^6 MCF7 cells (negative control, Left) and Jurkat cells (Right) were surface-stained with ABflo® 488 Rabbit anti-Human CD162/PSGL-1 mAb(A22630, 5 μl/Test, orange line) or ABflo® 488 Rabbit IgG isotype control (A22069, 5 μl/Test, blue line). Non-fluorescently stained cells were used as blank control (red line).

Flow cytometry:1X10^6 Jurkat cells were surface-stained with ABflo® 488 Rabbit IgG isotype control (A22069, 5 μl/Test, left) or ABflo® 488 Rabbit anti-Human CD162/PSGL-1 mAb(A22630, 5 μl/Test, right).
Please remember our product information: ABflo® 488 Rabbit anti-Human CD162/PSGL-1 mAb (Catalog Number: A22630) Abclonal


