ABflo® 488 Rabbit anti-Cat CD27 mAb (A23171)
$290.00 – $768.00
Abclonal ABflo® 488 Rabbit anti-Cat CD27 mAb (Catalog Number: A23171) encoded by this gene is a member of the TNF-receptor superfamily. This receptor is required for generation and long-term maintenance of T cell immunity.
- Details & Specifications
- References
| Catalog No. | A23171 |
|---|---|
| Product Name | ABflo® 488 Rabbit anti-Cat CD27 mAb (A23171) |
| Supplier Name | ABclonal, Inc. |
| Brand Name | Abclonal |
| Gene Name | CD27 |
| Protein Name | CD27 |
| Gene ID | 101091633 |
| Clonality | Monoclonal |
| Source/Host | Rabbit |
| Reactivity | Cat |
| Conjugate | ABflo® 488. Ex:491nm. Em:516nm. |
| Note | Products will be shipped from the warehouse in Massachusetts. Promotion is running from time to time. Welcome to send a request for quote to message@sydlabs.com. |
| Order Offline | Syd Labs, Inc. 4 Avenue E, Hopkinton, MA 01748 USA. Phone: 1-617-401-8149 Fax: 1-617-606-5019 Email: message@sydlabs.com |
Description
A23171: ABflo® 488 Rabbit anti-Cat CD27 mAb
The protein encoded by this gene is a member of the TNF-receptor superfamily. This receptor is required for generation and long-term maintenance of T cell immunity. It binds to ligand CD70, and plays a key role in regulating B-cell activation and immunoglobulin synthesis. This receptor transduces signals that lead to the activation of NF-kappaB and MAPK8/JNK. Adaptor proteins TRAF2 and TRAF5 have been shown to mediate the signaling process of this receptor. CD27-binding protein (SIVA), a proapoptotic protein, can bind to this receptor and is thought to play an important role in the apoptosis induced by this receptor.
Immunogen Information about ABflo® 488 Rabbit anti-Cat CD27 mAb (A23171)
Immunogen:Recombinant protein of cat CD27.
Sequence:ATLAPQCCPEKHYWAQGQLCCQMCKPGTFLVKDCDRHGEAAQCDPCIPGASFSPDHHIRRHCESCRHCNSGLLIRNCTLTANAECACPKGWQCRDKECTECDPPSNPSLTPRPPQAPGPHPQPTHLPYAKKMPEAGTVRQVQTLADFRWLPAPALSTHGPPQRSLCSTDCIR
Gene ID:101091633
Swiss prot:
Synonyms:
Calculated MW:
Observed MW:
Images of ABflo® 488 Rabbit anti-Cat CD27 mAb (A23171)

Flow cytometry:1X10^6 293F cells (negative control, Left) and 293F(Transfection, right) cells were surface-stained with ABflo® 488 Rabbit anti-Cat CD27 mAb(A23171, 5 μl/Test, orange line) or ABflo®488 Rabbit IgG isotype control (A22069, 5 μl/Test, blue line). Non-fluorescently stained cells were used as blank control (red line).

Flow cytometry:1X10^6 293F(Transfection) cells were surface-stained with ABflo® 488 Rabbit IgG isotype control (A22069, 5 μl/Test, left) or ABflo® 488 Rabbit anti-Cat CD27 mAb(A23171, 5 μl/Test, right).
Please remember our product information: ABflo® 488 Rabbit anti-Cat CD27 mAb (Catalog Number: A23171) Abclonal



