PAX5 Rabbit mAb (A9607)

PAX5 Rabbit mAb (A9607)

PAX5 Rabbit mAb (A9607)

$148.00$548.00

In stock

$148.00$548.00

Abclonal PAX5 Rabbit mAb (Catalog Number: A9607) encodes a member of the paired box (PAX) family of transcription factors. The central feature of this gene family is a novel, highly conserved DNA-binding motif, known as the paired box.

Store
SKU: A9607 Categories: ,
Clear
View cart
Order Offline:
Phone: 1-617-401-8149
Fax: 1-617-606-5019
Email: message@sydlabs.com
Catalog No. A9607
Product NamePAX5 Rabbit mAb (A9607)
Supplier Name ABclonal, Inc.
Brand Name Abclonal
Synonyms ALL3; BSAP; PAX-5
Gene Name PAX5
Protein Name PAX5
Uniprot/Swissprot ID Q02548
Gene ID 5079
Clone ARC1654
Clonality Monoclonal
Source/Host Rabbit
Reactivity Human
Conjugate Unconjugated
Note Products will be shipped from the warehouse in Massachusetts. Promotion is running from time to time. Welcome to send a request for quote to message@sydlabs.com.
Order Offline Syd Labs, Inc. 4 Avenue E, Hopkinton, MA 01748 USA. Phone: 1-617-401-8149 Fax: 1-617-606-5019 Email: message@sydlabs.com

Description

A9607: PAX5 Rabbit mAb

This gene encodes a member of the paired box (PAX) family of transcription factors. The central feature of this gene family is a novel, highly conserved DNA-binding motif, known as the paired box. Paired box transcription factors are important regulators in early development, and alterations in the expression of their genes are thought to contribute to neoplastic transformation. This gene encodes the B-cell lineage specific activator protein that is expressed at early, but not late stages of B-cell differentiation. Its expression has also been detected in developing CNS and testis and so the encoded protein may also play a role in neural development and spermatogenesis. This gene is located at 9p13, which is involved in t(9;14)(p13;q32) translocations recurring in small lymphocytic lymphomas of the plasmacytoid subtype, and in derived large-cell lymphomas. This translocation brings the potent E-mu enhancer of the IgH gene into close proximity of the PAX5 promoter, suggesting that the deregulation of transcription of this gene contributes to the pathogenesis of these lymphomas. Alternative splicing results in multiple transcript variants encoding different isoforms.

Immunogen Information about PAX5 Rabbit mAb (A9607)

Immunogen:A synthetic peptide corresponding to a sequence within amino acids 200-300 of human PAX5 (Q02548).
Sequence:DEGIQESPVPNGHSLPGRDFLRKQMRGDLFTQQQLEVLDRVFERQHYSDIFTTTEPIKPEQTTEYSAMASLAGGLDDMKANLASPTPADIGSSVPGPQSYP
Gene ID:5079
Swiss prot:Q02548
Synonyms:ALL3; BSAP; PAX-5; PAX5
Calculated MW:42kDa
Observed MW:45kDa

Images of PAX5 Rabbit mAb (A9607)

Western blot analysis of extracts of Raji cells, using PAX5 antibody (A9607) at 1:500 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.

Immunohistochemistry analysis of paraffin-embedded human spleen using PAX5 Rabbit mAb (A9607) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.

Please remember our product information: PAX5 Rabbit mAb (Catalog Number: A9607) Abclonal

No more offers for this product!