Myeloperoxidase (MPO) Rabbit mAb (A12109)
$148.00 – $548.00
Abclonal Myeloperoxidase (MPO) Rabbit mAb (Catalog Number: A12109) is a heme protein synthesized during myeloid differentiation that constitutes the major component of neutrophil azurophilic granules.
- Product Details
- Description
- Additional information
- More Offers
| Catalog No. | A12109 |
|---|---|
| Product Name | Myeloperoxidase (MPO) Rabbit mAb (A12109) |
| Supplier Name | ABclonal, Inc. |
| Brand Name | Abclonal |
| Gene Name | MPO |
| Protein Name | MPO |
| Uniprot/Swissprot ID | P05164 |
| Entrez GeneID | 4353 |
| Clone | ARC53227 |
| Clonality | Monoclonal |
| Source/Host | Rabbit |
| Applications | WB, IHC-P |
| Reactivity | Human, Mouse |
| Conjugate | Unconjugated |
| Note | Products will be shipped from the warehouse in Massachusetts. Promotion is running from time to time. Welcome to send a request for quote to message@sydlabs.com. |
| Order Offline | Syd Labs, Inc. 4 Avenue E, Hopkinton, MA 01748 USA. Phone: 1-617-401-8149 Fax: 1-617-606-5019 Email: message@sydlabs.com |
Description
A12109: Myeloperoxidase (MPO) Rabbit mAb
Myeloperoxidase (MPO) is a heme protein synthesized during myeloid differentiation that constitutes the major component of neutrophil azurophilic granules. Produced as a single chain precursor, myeloperoxidase is subsequently cleaved into a light and heavy chain. The mature myeloperoxidase is a tetramer composed of 2 light chains and 2 heavy chains. This enzyme produces hypohalous acids central to the microbicidal activity of neutrophils.
Immunogen Information about Myeloperoxidase (MPO) Rabbit mAb (A12109)
Immunogen：A synthetic peptide corresponding to a sequence within amino acids 646-745 of human Myeloperoxidase (MPO) (NP_000241.1).
Sequence：GVSEPLKRKGRVGPLLACIIGTQFRKLRDGDRFWWENEGVFSMQQRQALAQISLPRIICDNTGITTVSKNNIFMSNSYPRDFVNCSTLPALNLASWREAS
Gene ID：4353
Swiss prot：P05164
Synonyms：
Calculated MW：84kDa
Observed MW：13kDa
Images of Myeloperoxidase (MPO) Rabbit mAb (A12109)
Western blot analysis of extracts of HL-60 cells, using Myeloperoxidase (MPO) antibody (A12109) at 1:500 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 3s.
Immunohistochemistry analysis of paraffin-embedded human colon carcinoma using Myeloperoxidase (MPO) Rabbit mAb (A12109) at dilution of 1:1000 (40x lens).Perform high pressure antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.
Immunohistochemistry analysis of paraffin-embedded human extranodal NK-T cell lymphoma using Myeloperoxidase (MPO) Rabbit mAb (A12109) at dilution of 1:1000 (40x lens).Perform high pressure antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.
Immunohistochemistry analysis of paraffin-embedded Human hepatocholangiocarcinoma using Myeloperoxidase (MPO) Rabbit mAb (A12109) at dilution of 1:1000 (40x lens).Perform high pressure antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.
Immunohistochemistry analysis of paraffin-embedded human liver using Myeloperoxidase (MPO) Rabbit mAb (A12109) at dilution of 1:1000 (40x lens).Perform high pressure antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.
Immunohistochemistry analysis of paraffin-embedded human tonsil using Myeloperoxidase (MPO) Rabbit mAb (A12109) at dilution of 1:1000 (40x lens).Perform high pressure antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.
Please remember our product information: Myeloperoxidase (MPO) Rabbit mAb (Catalog Number: A12109) Abclonal
Additional information
| Ship from Country | USA |
|---|---|
| Size | 20 ul, 100 ul, 200 ul, 50 ul |