Mammaglobin A Rabbit mAb (A19727)

Mammaglobin A Rabbit mAb (A19727)

Mammaglobin A Rabbit mAb (A19727)

$148.00$548.00

In stock

$148.00$548.00

Abclonal Mammaglobin A Rabbit mAb (Catalog Number: A19727) Predicted to be involved in androgen receptor signaling pathway. Predicted to be located in extracellular region. Predicted to be active in extracellular space.

Store
SKU: A19727 Categories: ,
Clear
View cart
Order Offline:
Phone: 1-617-401-8149
Fax: 1-617-606-5019
Email: message@sydlabs.com
Catalog No. A19727
Product NameMammaglobin A Rabbit mAb (A19727)
Supplier Name ABclonal, Inc.
Brand Name Abclonal
Synonyms MGB1; UGB2; PSBP1
Gene Name SCGB2A2
Protein Name SCGB2A2
Uniprot/Swissprot ID Q13296
Gene ID 4250
Clone ARC2255
Clonality Monoclonal
Source/Host Rabbit
Reactivity Human
Conjugate Unconjugated
Note Products will be shipped from the warehouse in Massachusetts. Promotion is running from time to time. Welcome to send a request for quote to message@sydlabs.com.
Order Offline Syd Labs, Inc. 4 Avenue E, Hopkinton, MA 01748 USA. Phone: 1-617-401-8149 Fax: 1-617-606-5019 Email: message@sydlabs.com

Description

A19727: Mammaglobin A Rabbit mAb

Predicted to be involved in androgen receptor signaling pathway. Predicted to be located in extracellular region. Predicted to be active in extracellular space.

Immunogen Information about Mammaglobin A Rabbit mAb (A19727)

Immunogen:Recombinant fusion protein containing a sequence corresponding to amino acids 1-93 of human Mammaglobin A (Q13296).
Sequence:MKLLMVLMLAALSQHCYAGSGCPLLENVISKTINPQVSKTEYKELLQEFIDDNATTNAIDELKECFLNQTDETLSNVEVFMQLIYDSSLCDLF
Gene ID:4250
Swiss prot:Q13296
Synonyms:MGB1; UGB2; PSBP1; Mammaglobin A
Calculated MW:10kDa
Observed MW:10kDa

Images of Mammaglobin A Rabbit mAb (A19727)

Western blot analysis of extracts of BT-474 cells, using Mammaglobin A Rabbit mAb (A19727) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 60s.

Immunohistochemistry analysis of paraffin-embedded human breast cancer using Mammaglobin A Rabbit mAb (A19727) at dilution of 1:200 (40x lens).Perform high pressure antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.

Immunohistochemistry analysis of paraffin-embedded human breast using Mammaglobin A Rabbit mAb (A19727) at dilution of 1:200 (40x lens).Perform high pressure antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.

Immunohistochemistry analysis of paraffin-embedded human skin using Mammaglobin A Rabbit mAb (A19727) at dilution of 1:200 (40x lens).Perform high pressure antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.

Please remember our product information: Mammaglobin A Rabbit mAb (Catalog Number: A19727) Abclonal