Mammaglobin A Rabbit mAb (A19727)
$148.00 – $548.00
Abclonal Mammaglobin A Rabbit mAb (Catalog Number: A19727) Predicted to be involved in androgen receptor signaling pathway. Predicted to be located in extracellular region. Predicted to be active in extracellular space.
- Details & Specifications
- References
- More Offers
| Catalog No. | A19727 |
|---|---|
| Product Name | Mammaglobin A Rabbit mAb (A19727) |
| Supplier Name | ABclonal, Inc. |
| Brand Name | Abclonal |
| Synonyms | MGB1; UGB2; PSBP1 |
| Gene Name | SCGB2A2 |
| Protein Name | SCGB2A2 |
| Uniprot/Swissprot ID | Q13296 |
| Gene ID | 4250 |
| Clone | ARC2255 |
| Clonality | Monoclonal |
| Source/Host | Rabbit |
| Reactivity | Human |
| Conjugate | Unconjugated |
| Note | Products will be shipped from the warehouse in Massachusetts. Promotion is running from time to time. Welcome to send a request for quote to message@sydlabs.com. |
| Order Offline | Syd Labs, Inc. 4 Avenue E, Hopkinton, MA 01748 USA. Phone: 1-617-401-8149 Fax: 1-617-606-5019 Email: message@sydlabs.com |
Description
A19727: Mammaglobin A Rabbit mAb
Predicted to be involved in androgen receptor signaling pathway. Predicted to be located in extracellular region. Predicted to be active in extracellular space.
Immunogen Information about Mammaglobin A Rabbit mAb (A19727)
Immunogen：Recombinant fusion protein containing a sequence corresponding to amino acids 1-93 of human Mammaglobin A (Q13296).
Sequence：MKLLMVLMLAALSQHCYAGSGCPLLENVISKTINPQVSKTEYKELLQEFIDDNATTNAIDELKECFLNQTDETLSNVEVFMQLIYDSSLCDLF
Gene ID：4250
Swiss prot：Q13296
Synonyms：MGB1; UGB2; PSBP1; Mammaglobin A
Calculated MW：10kDa
Observed MW：10kDa
Images of Mammaglobin A Rabbit mAb (A19727)
Western blot analysis of extracts of BT-474 cells, using Mammaglobin A Rabbit mAb (A19727) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 60s.
Immunohistochemistry analysis of paraffin-embedded human breast cancer using Mammaglobin A Rabbit mAb (A19727) at dilution of 1:200 (40x lens).Perform high pressure antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.
Immunohistochemistry analysis of paraffin-embedded human breast using Mammaglobin A Rabbit mAb (A19727) at dilution of 1:200 (40x lens).Perform high pressure antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.
Immunohistochemistry analysis of paraffin-embedded human skin using Mammaglobin A Rabbit mAb (A19727) at dilution of 1:200 (40x lens).Perform high pressure antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.
Please remember our product information: Mammaglobin A Rabbit mAb (Catalog Number: A19727) Abclonal
