Cytokeratin 7 (CK7) Rabbit mAb (A4357)

Cytokeratin 7 (CK7) Rabbit mAb (A4357)

Cytokeratin 7 (CK7) Rabbit mAb (A4357)

$148.00$548.00

In stock

$148.00$548.00

Abclonal Cytokeratin 7 (CK7) Rabbit mAb (Catalog Number: A4357) encoded by this gene is a member of the keratin gene family. The type II cytokeratins consist of basic or neutral proteins which are arranged in pairs of heterotypic keratin chains coexpressed during differentiation of simple and stratified epithelial tissues.

Store
SKU: A4357
Clear
View cart
Catalog No. A4357
Product NameCytokeratin 7 (CK7) Rabbit mAb (A4357)
Supplier Name ABclonal, Inc.
Brand Name Abclonal
Synonyms K7; CK7; SCL; K2C7
Gene Name KRT7
Protein Name KRT7
Uniprot/Swissprot ID P08729
Entrez GeneID 3855
Clone ARC0978
Clonality Monoclonal
Source/Host Rabbit
Applications WB, IHC-P, IF/ICC
Reactivity Human, Mouse, Rat
Conjugate Unconjugated
Note Products will be shipped from the warehouse in Massachusetts. Promotion is running from time to time. Welcome to send a request for quote to message@sydlabs.com.
Order Offline Syd Labs, Inc. 4 Avenue E, Hopkinton, MA 01748 USA. Phone: 1-617-401-8149 Fax: 1-617-606-5019 Email: message@sydlabs.com

Description

A4357: Cytokeratin 7 (CK7) Rabbit mAb

The protein encoded by this gene is a member of the keratin gene family. The type II cytokeratins consist of basic or neutral proteins which are arranged in pairs of heterotypic keratin chains coexpressed during differentiation of simple and stratified epithelial tissues. This type II cytokeratin is specifically expressed in the simple epithelia lining the cavities of the internal organs and in the gland ducts and blood vessels. The genes encoding the type II cytokeratins are clustered in a region of chromosome 12q12-q13. Alternative splicing may result in several transcript variants; however, not all variants have been fully described.

Immunogen Information about Cytokeratin 7 (CK7) Rabbit mAb (A4357)

Immunogen:Recombinant fusion protein containing a sequence corresponding to amino acids 291-463 of human Cytokeratin 7 (KRT7) (P08729).
Sequence:QAQAGKHGDDLRNTRNEISEMNRAIQRLQAEIDNIKNQRAKLEAAIAEAEERGELALKDARAKQEELEAALQRGKQDMARQLREYQELMSVKLALDIEIATYRKLLEGEESRLAGDGVGAVNISVMNSTGGSSSGGGIGLTLGGTMGSNALSFSSSAGPGLLKAYSIRTASAS
Gene ID:3855
Swiss prot:P08729
Synonyms:K7; KRT7; SCL; K2C7; Cytokeratin 7 (CK7)
Calculated MW:51kDa
Observed MW:55kDa

Images of Cytokeratin 7 (CK7) Rabbit mAb (A4357)

Western blot analysis of various lysates using Cytokeratin 7 (KRT7) (KRT7) Rabbit mAb (A4357) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.

Immunohistochemistry analysis of Cytokeratin 7 (CK7) in paraffin-embedded human breast using Cytokeratin 7 (KRT7) Rabbit mAb (A4357) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

Immunohistochemistry analysis of Cytokeratin 7 (CK7) in paraffin-embedded Human lung adenocarcinoma using Cytokeratin 7 (KRT7) Rabbit mAb (A4357) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

Immunohistochemistry analysis of Cytokeratin 7 (CK7) in paraffin-embedded human lung using Cytokeratin 7 (KRT7) Rabbit mAb (A4357) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

Immunofluorescence analysis of paraffin-embedded Human lung using Cytokeratin 7 (CK7) Rabbit mAb (A4357) at dilution of 1:50 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Immunofluorescence analysis of paraffin-embedded Mouse lung using Cytokeratin 7 (CK7) Rabbit mAb (A4357) at dilution of 1:50 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Immunofluorescence analysis of paraffin-embedded Rat lung using Cytokeratin 7 (CK7) Rabbit mAb (A4357) at dilution of 1:50 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Please remember our product information: Cytokeratin 7 (CK7) Rabbit mAb (Catalog Number: A4357) Abclonal

Additional information

Ship from Country

USA

Size

20 ul, 100 ul, 200 ul, 50 ul

No more offers for this product!