Cytokeratin 19 (KRT19) Rabbit mAb (A22427)

Cytokeratin 19 (KRT19) Rabbit mAb (A22427)

Cytokeratin 19 (KRT19) Rabbit mAb (A22427)

$148.00$548.00

In stock

$148.00$548.00

Abclonal Cytokeratin 19 (KRT19) Rabbit mAb (Catalog Number: A22427) encoded by this gene is a member of the keratin family. The keratins are intermediate filament proteins responsible for the structural integrity of epithelial cells and are subdivided into cytokeratins and hair keratins.

Store
SKU: A22427 Categories: ,
Clear
View cart
Order Offline:
Phone: 1-617-401-8149
Fax: 1-617-606-5019
Email: message@sydlabs.com
Catalog No. A22427
Product NameCytokeratin 19 (KRT19) Rabbit mAb (A22427)
Supplier Name ABclonal, Inc.
Brand Name Abclonal
Synonyms K19; CK19; K1CS
Gene Name KRT19
Protein Name KRT19
Uniprot/Swissprot ID P08727
Gene ID 3880
Clone ARC0272
Clonality Monoclonal
Source/Host Rabbit
Reactivity Human, Mouse, Rat
Conjugate Unconjugated
Note Products will be shipped from the warehouse in Massachusetts. Promotion is running from time to time. Welcome to send a request for quote to message@sydlabs.com.
Order Offline Syd Labs, Inc. 4 Avenue E, Hopkinton, MA 01748 USA. Phone: 1-617-401-8149 Fax: 1-617-606-5019 Email: message@sydlabs.com

Description

A22427: Cytokeratin 19 (KRT19) Rabbit mAb

The protein encoded by this gene is a member of the keratin family. The keratins are intermediate filament proteins responsible for the structural integrity of epithelial cells and are subdivided into cytokeratins and hair keratins. The type I cytokeratins consist of acidic proteins which are arranged in pairs of heterotypic keratin chains. Unlike its related family members, this smallest known acidic cytokeratin is not paired with a basic cytokeratin in epithelial cells. It is specifically expressed in the periderm, the transiently superficial layer that envelopes the developing epidermis. The type I cytokeratins are clustered in a region of chromosome 17q12-q21.

Immunogen Information about Cytokeratin 19 (KRT19) Rabbit mAb (A22427)

Immunogen:A synthetic peptide corresponding to a sequence within amino acids 301-400 of human Cytokeratin 19 (KRT19) (P08727).
Sequence:RTLQGLEIELQSQLSMKAALEDTLAETEARFGAQLAHIQALISGIEAQLGDVRADSERQNQEYQRLMDIKSRLEQEIATYRSLLEGQEDHYNNLSASKVL
Gene ID:3880
Swiss prot:P08727
Synonyms:K19; CK19; K1CS; Cytokeratin 19 (KRT19)
Calculated MW:44kDa
Observed MW:Refer to figures

Images of Cytokeratin 19 (KRT19) Rabbit mAb (A22427)

Immunohistochemistry analysis of paraffin-embedded human colon carcinoma using Cytokeratin 19 (KRT19) Rabbit mAb (A22427) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

Immunohistochemistry analysis of paraffin-embedded human kidney using Cytokeratin 19 (KRT19) Rabbit mAb (A22427) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

Immunohistochemistry analysis of paraffin-embedded human liver using Cytokeratin 19 (KRT19) Rabbit mAb (A22427) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

Immunohistochemistry analysis of paraffin-embedded human tonsil using Cytokeratin 19 (KRT19) Rabbit mAb (A22427) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

Please remember our product information: Cytokeratin 19 (KRT19) Rabbit mAb (Catalog Number: A22427) Abclonal