Cytokeratin 19 (KRT19) Rabbit mAb (A22427)
$148.00 – $548.00
Abclonal Cytokeratin 19 (KRT19) Rabbit mAb (Catalog Number: A22427) encoded by this gene is a member of the keratin family. The keratins are intermediate filament proteins responsible for the structural integrity of epithelial cells and are subdivided into cytokeratins and hair keratins.
- Details & Specifications
- References
- More Offers
| Catalog No. | A22427 |
|---|---|
| Product Name | Cytokeratin 19 (KRT19) Rabbit mAb (A22427) |
| Supplier Name | ABclonal, Inc. |
| Brand Name | Abclonal |
| Synonyms | K19; CK19; K1CS |
| Gene Name | KRT19 |
| Protein Name | KRT19 |
| Uniprot/Swissprot ID | P08727 |
| Gene ID | 3880 |
| Clone | ARC0272 |
| Clonality | Monoclonal |
| Source/Host | Rabbit |
| Reactivity | Human, Mouse, Rat |
| Conjugate | Unconjugated |
| Note | Products will be shipped from the warehouse in Massachusetts. Promotion is running from time to time. Welcome to send a request for quote to message@sydlabs.com. |
| Order Offline | Syd Labs, Inc. 4 Avenue E, Hopkinton, MA 01748 USA. Phone: 1-617-401-8149 Fax: 1-617-606-5019 Email: message@sydlabs.com |
Description
A22427: Cytokeratin 19 (KRT19) Rabbit mAb
The protein encoded by this gene is a member of the keratin family. The keratins are intermediate filament proteins responsible for the structural integrity of epithelial cells and are subdivided into cytokeratins and hair keratins. The type I cytokeratins consist of acidic proteins which are arranged in pairs of heterotypic keratin chains. Unlike its related family members, this smallest known acidic cytokeratin is not paired with a basic cytokeratin in epithelial cells. It is specifically expressed in the periderm, the transiently superficial layer that envelopes the developing epidermis. The type I cytokeratins are clustered in a region of chromosome 17q12-q21.
Immunogen Information about Cytokeratin 19 (KRT19) Rabbit mAb (A22427)
Immunogen：A synthetic peptide corresponding to a sequence within amino acids 301-400 of human Cytokeratin 19 (KRT19) (P08727).
Sequence：RTLQGLEIELQSQLSMKAALEDTLAETEARFGAQLAHIQALISGIEAQLGDVRADSERQNQEYQRLMDIKSRLEQEIATYRSLLEGQEDHYNNLSASKVL
Gene ID：3880
Swiss prot：P08727
Synonyms：K19; CK19; K1CS; Cytokeratin 19 (KRT19)
Calculated MW：44kDa
Observed MW：Refer to figures
Images of Cytokeratin 19 (KRT19) Rabbit mAb (A22427)
Immunohistochemistry analysis of paraffin-embedded human colon carcinoma using Cytokeratin 19 (KRT19) Rabbit mAb (A22427) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
Immunohistochemistry analysis of paraffin-embedded human kidney using Cytokeratin 19 (KRT19) Rabbit mAb (A22427) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
Immunohistochemistry analysis of paraffin-embedded human liver using Cytokeratin 19 (KRT19) Rabbit mAb (A22427) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
Immunohistochemistry analysis of paraffin-embedded human tonsil using Cytokeratin 19 (KRT19) Rabbit mAb (A22427) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
Please remember our product information: Cytokeratin 19 (KRT19) Rabbit mAb (Catalog Number: A22427) Abclonal
