CD3E Rabbit mAb (A23504)

CD3E Rabbit mAb (A23504)

CD3E Rabbit mAb (A23504)

$148.00$548.00

In stock

$148.00$548.00

Abclonal CD3E Rabbit mAb (Catalog Number: A23504) encoded by this gene is the CD3-epsilon polypeptide, which together with CD3-gamma, -delta and -zeta, and the T-cell receptor alpha/beta and gamma/delta heterodimers, forms the T-cell receptor-CD3 complex.

Store
SKU: A23504 Categories: ,
Clear
View cart
Order Offline:
Phone: 1-617-401-8149
Fax: 1-617-606-5019
Email: message@sydlabs.com
Catalog No. A23504
Product NameCD3E Rabbit mAb (A23504)
Supplier Name ABclonal, Inc.
Brand Name Abclonal
Synonyms T3E; TCRE; IMD18; CD3epsilon
Gene Name CD3E
Protein Name CD3E
Uniprot/Swissprot ID P07766
Gene ID 916
Clone ARC0327
Clonality Monoclonal
Source/Host Rabbit
Reactivity Human
Conjugate Unconjugated
Note Products will be shipped from the warehouse in Massachusetts. Promotion is running from time to time. Welcome to send a request for quote to message@sydlabs.com.
Order Offline Syd Labs, Inc. 4 Avenue E, Hopkinton, MA 01748 USA. Phone: 1-617-401-8149 Fax: 1-617-606-5019 Email: message@sydlabs.com

Description

A23504: CD3E Rabbit mAb

The protein encoded by this gene is the CD3-epsilon polypeptide, which together with CD3-gamma, -delta and -zeta, and the T-cell receptor alpha/beta and gamma/delta heterodimers, forms the T-cell receptor-CD3 complex. This complex plays an important role in coupling antigen recognition to several intracellular signal-transduction pathways. The genes encoding the epsilon, gamma and delta polypeptides are located in the same cluster on chromosome 11. The epsilon polypeptide plays an essential role in T-cell development. Defects in this gene cause immunodeficiency. This gene has also been linked to a susceptibility to type I diabetes in women.

Immunogen Information about CD3E Rabbit mAb (A23504)

Immunogen:A synthetic peptide corresponding to a sequence within amino acids 100-200 of human CD3E (NP_000724.1).
Sequence:PRGSKPEDANFYLYLRARVCENCMEMDVMSVATIVIVDICITGGLLLLVYYWSKNRKAKAKPVTRGAGAGGRQRGQNKERPPPVPNPDYEPIRKGQRDLYS
Gene ID:916
Swiss prot:P07766
Synonyms:T3E; TCRE; IMD18; CD3epsilon; CD3E
Calculated MW:23kDa
Observed MW:Refer to figures

Images of CD3E Rabbit mAb (A23504)

Western blot analysis of lysates from Jurkat cells, using CD3E Rabbit mAb (A23504) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 3min.

Immunohistochemistry analysis of CD3E in paraffin-embedded human colon using CD3E Rabbit mAb (A23504) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

Immunohistochemistry analysis of CD3E in paraffin-embedded Human Follicular lymphoma using CD3E Rabbit mAb (A23504) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

Immunohistochemistry analysis of CD3E in paraffin-embedded human tonsil using CD3E Rabbit mAb (A23504) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

Flow cytometry:1X10^6 Raji cells (negative control, left) and Jurkat cells (right) were surface-stained with CD3E Rabbit mAb(A23504, 2 μg/mL, orange line) or ABflo® 488 Rabbit IgG isotype control (A22069, 2 μg/mL, blue line), followed by Alexa Fluor® 488 conjugated goat anti-rabbit pAb (1:200 dilution) staining. Non-fluorescently stained cells were used as blank control (red line).

Please remember our product information: CD3E Rabbit mAb (Catalog Number: A23504) Abclonal