CD3E Rabbit mAb (A23504)
$148.00 – $548.00
Abclonal CD3E Rabbit mAb (Catalog Number: A23504) encoded by this gene is the CD3-epsilon polypeptide, which together with CD3-gamma, -delta and -zeta, and the T-cell receptor alpha/beta and gamma/delta heterodimers, forms the T-cell receptor-CD3 complex.
- Details & Specifications
- References
| Catalog No. | A23504 |
|---|---|
| Product Name | CD3E Rabbit mAb (A23504) |
| Supplier Name | ABclonal, Inc. |
| Brand Name | Abclonal |
| Synonyms | T3E; TCRE; IMD18; CD3epsilon |
| Gene Name | CD3E |
| Protein Name | CD3E |
| Uniprot/Swissprot ID | P07766 |
| Gene ID | 916 |
| Clone | ARC0327 |
| Clonality | Monoclonal |
| Source/Host | Rabbit |
| Reactivity | Human |
| Conjugate | Unconjugated |
| Note | Products will be shipped from the warehouse in Massachusetts. Promotion is running from time to time. Welcome to send a request for quote to message@sydlabs.com. |
| Order Offline | Syd Labs, Inc. 4 Avenue E, Hopkinton, MA 01748 USA. Phone: 1-617-401-8149 Fax: 1-617-606-5019 Email: message@sydlabs.com |
Description
A23504: CD3E Rabbit mAb
The protein encoded by this gene is the CD3-epsilon polypeptide, which together with CD3-gamma, -delta and -zeta, and the T-cell receptor alpha/beta and gamma/delta heterodimers, forms the T-cell receptor-CD3 complex. This complex plays an important role in coupling antigen recognition to several intracellular signal-transduction pathways. The genes encoding the epsilon, gamma and delta polypeptides are located in the same cluster on chromosome 11. The epsilon polypeptide plays an essential role in T-cell development. Defects in this gene cause immunodeficiency. This gene has also been linked to a susceptibility to type I diabetes in women.
Immunogen Information about CD3E Rabbit mAb (A23504)
Immunogen：A synthetic peptide corresponding to a sequence within amino acids 100-200 of human CD3E (NP_000724.1).
Sequence：PRGSKPEDANFYLYLRARVCENCMEMDVMSVATIVIVDICITGGLLLLVYYWSKNRKAKAKPVTRGAGAGGRQRGQNKERPPPVPNPDYEPIRKGQRDLYS
Gene ID：916
Swiss prot：P07766
Synonyms：T3E; TCRE; IMD18; CD3epsilon; CD3E
Calculated MW：23kDa
Observed MW：Refer to figures
Images of CD3E Rabbit mAb (A23504)
Western blot analysis of lysates from Jurkat cells, using CD3E Rabbit mAb (A23504) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 3min.
Immunohistochemistry analysis of CD3E in paraffin-embedded human colon using CD3E Rabbit mAb (A23504) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
Immunohistochemistry analysis of CD3E in paraffin-embedded Human Follicular lymphoma using CD3E Rabbit mAb (A23504) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
Immunohistochemistry analysis of CD3E in paraffin-embedded human tonsil using CD3E Rabbit mAb (A23504) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
Flow cytometry:1X10^6 Raji cells (negative control, left) and Jurkat cells (right) were surface-stained with CD3E Rabbit mAb(A23504, 2 μg/mL, orange line) or ABflo® 488 Rabbit IgG isotype control (A22069, 2 μg/mL, blue line), followed by Alexa Fluor® 488 conjugated goat anti-rabbit pAb (1:200 dilution) staining. Non-fluorescently stained cells were used as blank control (red line).
Please remember our product information: CD3E Rabbit mAb (Catalog Number: A23504) Abclonal
