ABflo® 647 Rabbit anti-Mouse Ly-6A/E (Sca-1) mAb (A22787)

ABflo® 647 Rabbit anti-Mouse Ly-6A/E (Sca-1) mAb (A22787)

ABflo® 647 Rabbit anti-Mouse Ly-6A/E (Sca-1) mAb (A22787)

$218.00$568.00

In stock

$218.00$568.00

Abclonal ABflo® 647 Rabbit anti-Mouse Ly-6A/E (Sca-1) mAb (Catalog Number: A22787) Predicted to enable acetylcholine receptor binding activity and acetylcholine receptor inhibitor activity. Acts upstream of or within response to bacterium.

Store
SKU: A22787 Categories: ,
Clear
View cart
Order Offline:
Phone: 1-617-401-8149
Fax: 1-617-606-5019
Email: message@sydlabs.com
Catalog No. A22787
Product NameABflo® 647 Rabbit anti-Mouse Ly-6A/E (Sca-1) mAb (A22787)
Supplier Name ABclonal, Inc.
Brand Name Abclonal
Synonyms TAP; Sca1; Sca-1; Ly-6A.2; Ly-6A/E; Ly-6E.1
Gene Name Ly6a
Protein Name Ly6a
Uniprot/Swissprot ID P08648
Gene ID 110454
Clonality Monoclonal
Source/Host Rabbit
Reactivity Mouse
Conjugate ABflo® 647. Ex:656nm. Em:670nm.
Note Products will be shipped from the warehouse in Massachusetts. Promotion is running from time to time. Welcome to send a request for quote to message@sydlabs.com.
Order Offline Syd Labs, Inc. 4 Avenue E, Hopkinton, MA 01748 USA. Phone: 1-617-401-8149 Fax: 1-617-606-5019 Email: message@sydlabs.com

Description

A22787: ABflo® 647 Rabbit anti-Mouse Ly-6A/E (Sca-1) mAb

Predicted to enable acetylcholine receptor binding activity and acetylcholine receptor inhibitor activity. Acts upstream of or within response to bacterium. Located in external side of plasma membrane. Is expressed in alimentary system; hindlimb tendon; liver; metanephros; and physiological umbilical hernia. Used to study osteoporosis. Orthologous to human LY6H (lymphocyte antigen 6 family member H).

Immunogen Information about ABflo® 647 Rabbit anti-Mouse Ly-6A/E (Sca-1) mAb (A22787)

Immunogen:Recombinant fusion protein containing a sequence corresponding to amino acids 27-111 of Mouse Ly-6A/E (Sca-1)(NP_034868.1)
Sequence:LECYQCYGVPFETSCPSITCPYPDGVCVTQEAAVIVDSQTRKVKNNLCLPICPPNIESMEILGTKVNVKTSCCQEDLCNVAVPNG
Gene ID:110454
Swiss prot:P08648
Synonyms:TAP; Sca1; Sca-1; Ly-6A.2; Ly-6A/E; Ly-6E.1
Calculated MW:14kDa
Observed MW:Refer to figures

Images of ABflo® 647 Rabbit anti-Mouse Ly-6A/E (Sca-1) mAb (A22787)

Flow cytometry:1X10^6 RAW 264.7 cells (negative control, Left) and C57BL/6 mouse splenocytes (Right) were surface-stained with ABflo® 647 Rabbit anti-Mouse Ly-6A/E (Sca-1) mAb(A22787, 5 μl/Test, orange line) or ABflo® 647 Rabbit IgG isotype control (A22070, 5 μl/Test, blue line). Non-fluorescently stained cells were used as blank control (red line).

Flow cytometry:1X10^6 C57BL/6 mouse splenocytes were surface-stained with ABflo® 647 Rabbit IgG isotype control (A22070, 5 μl/Test, left) or ABflo® 647 Rabbit anti-Mouse Ly-6A/E(Sca-1) mAb(A22787, 5 μl/Test, right).

Please remember our product information: ABflo® 647 Rabbit anti-Mouse Ly-6A/E (Sca-1) mAb (Catalog Number: A22787) Abclonal

No more offers for this product!