ABflo® 647 Rabbit anti-Human Cytokeratin 19 (KRT19) mAb (A22066)

ABflo® 647 Rabbit anti-Human Cytokeratin 19 (KRT19) mAb (A22066)

ABflo® 647 Rabbit anti-Human Cytokeratin 19 (KRT19) mAb (A22066)

$290.00$768.00

In stock

$290.00$768.00

Abclonal ABflo® 647 Rabbit anti-Human Cytokeratin 19 (KRT19) mAb (Catalog Number: A22066) encoded by this gene is a member of the keratin family. The keratins are intermediate filament proteins responsible for the structural integrity of epithelial cells and are subdivided into cytokeratins and hair keratins.

Store
SKU: A22066 Categories: ,
Clear
View cart
Order Offline:
Phone: 1-617-401-8149
Fax: 1-617-606-5019
Email: message@sydlabs.com
Catalog No. A22066
Product NameABflo® 647 Rabbit anti-Human Cytokeratin 19 (KRT19) mAb (A22066)
Supplier Name ABclonal, Inc.
Brand Name Abclonal
Synonyms K19; CK19; K1CS
Gene Name KRT19
Protein Name KRT19
Uniprot/Swissprot ID P08727
Gene ID 3880
Clonality Monoclonal
Source/Host Rabbit
Reactivity Human
Conjugate ABflo® 647. Ex:656nm. Em:670nm.
Note Products will be shipped from the warehouse in Massachusetts. Promotion is running from time to time. Welcome to send a request for quote to message@sydlabs.com.
Order Offline Syd Labs, Inc. 4 Avenue E, Hopkinton, MA 01748 USA. Phone: 1-617-401-8149 Fax: 1-617-606-5019 Email: message@sydlabs.com

Description

A22066: ABflo® 647 Rabbit anti-Human Cytokeratin 19 (KRT19) mAb

The protein encoded by this gene is a member of the keratin family. The keratins are intermediate filament proteins responsible for the structural integrity of epithelial cells and are subdivided into cytokeratins and hair keratins. The type I cytokeratins consist of acidic proteins which are arranged in pairs of heterotypic keratin chains. Unlike its related family members, this smallest known acidic cytokeratin is not paired with a basic cytokeratin in epithelial cells. It is specifically expressed in the periderm, the transiently superficial layer that envelopes the developing epidermis. The type I cytokeratins are clustered in a region of chromosome 17q12-q21.

Immunogen Information about ABflo® 647 Rabbit anti-Human Cytokeratin 19 (KRT19) mAb (A22066)

Immunogen:A synthetic peptide corresponding to a sequence within amino acids 301-400 of human Cytokeratin 19 (NP_002267.2).
Sequence:RTLQGLEIELQSQLSMKAALEDTLAETEARFGAQLAHIQALISGIEAQLGDVRADSERQNQEYQRLMDIKSRLEQEIATYRSLLEGQEDHYNNLSASKVL
Gene ID:3880
Swiss prot:P08727
Synonyms:K19; CK19; K1CS
Calculated MW:44kDa
Observed MW:Refer to figures

Images of ABflo® 647 Rabbit anti-Human Cytokeratin 19 (KRT19) mAb (A22066)

Flow cytometry:1X10^6 Jurkat cells (negative control, left) and MCF7 cells (right) were intracellularly-stained with ABflo® 647 Rabbit anti-Human Cytokeratin 19 (KRT19) mAb(A22066, 5 μl/Test, orange line) or ABflo® 647 Rabbit IgG isotype control (A22070, 5 μl/Test, blue line). Non-fluorescently stained cells were used as blank control (red line).

Please remember our product information: ABflo® 647 Rabbit anti-Human Cytokeratin 19 (KRT19) mAb (Catalog Number: A22066) Abclonal

No more offers for this product!