ABflo® 647 Rabbit anti-Human CD120b/TNFRSF1B mAb (A23222)

ABflo® 647 Rabbit anti-Human CD120b/TNFRSF1B mAb (A23222)

ABflo® 647 Rabbit anti-Human CD120b/TNFRSF1B mAb (A23222)

$290.00$768.00

In stock

$290.00$768.00

Abclonal ABflo® 647 Rabbit anti-Human CD120b/TNFRSF1B mAb (Catalog Number: A23222) encoded by this gene is a member of the TNF-receptor superfamily.

Store
SKU: A23222 Categories: ,
Clear
View cart
Order Offline:
Phone: 1-617-401-8149
Fax: 1-617-606-5019
Email: message@sydlabs.com
Catalog No. A23222
Product NameABflo® 647 Rabbit anti-Human CD120b/TNFRSF1B mAb (A23222)
Supplier Name ABclonal, Inc.
Brand Name Abclonal
Synonyms p75; TBPII; TNFBR; TNFR2; CD120b; TNFR1B; TNFR80; TNF-R75; p75TNFR; TNF-R-II
Gene Name TNFRSF1B
Protein Name TNFRSF1B
Uniprot/Swissprot ID P20333
Gene ID 7133
Clonality Monoclonal
Source/Host Rabbit
Reactivity Human
Conjugate ABflo® 647. Ex:656nm. Em:670nm.
Note Products will be shipped from the warehouse in Massachusetts. Promotion is running from time to time. Welcome to send a request for quote to message@sydlabs.com.
Order Offline Syd Labs, Inc. 4 Avenue E, Hopkinton, MA 01748 USA. Phone: 1-617-401-8149 Fax: 1-617-606-5019 Email: message@sydlabs.com

Description

A23222: ABflo® 647 Rabbit anti-Human CD120b/TNFRSF1B mAb

The protein encoded by this gene is a member of the TNF-receptor superfamily. This protein and TNF-receptor 1 form a heterocomplex that mediates the recruitment of two anti-apoptotic proteins, c-IAP1 and c-IAP2, which possess E3 ubiquitin ligase activity. The function of IAPs in TNF-receptor signalling is unknown, however, c-IAP1 is thought to potentiate TNF-induced apoptosis by the ubiquitination and degradation of TNF-receptor-associated factor 2, which mediates anti-apoptotic signals. Knockout studies in mice also suggest a role of this protein in protecting neurons from apoptosis by stimulating antioxidative pathways.

Immunogen Information about ABflo® 647 Rabbit anti-Human CD120b/TNFRSF1B mAb (A23222)

Immunogen:Recombinant fusion protein containing a sequence corresponding to amino acids 23-257 of human CD120b/TNFRSF1B (NP_001057.1).
Sequence:LPAQVAFTPYAPEPGSTCRLREYYDQTAQMCCSKCSPGQHAKVFCTKTSDTVCDSCEDSTYTQLWNWVPECLSCGSRCSSDQVETQACTREQNRICTCRPGWYCALSKQEGCRLCAPLRKCRPGFGVARPGTETSDVVCKPCAPGTFSNTTSSTDICRPHQICNVVAIPGNASMDAVCTSTSPTRSMAPGAVHLPQPVSTRSQHTQPTPEPSTAPSTSFLLPMGPSPPAEGSTGD
Gene ID:7133
Swiss prot:P20333
Synonyms:p75; TBPII; TNFBR; TNFR2; CD120b; TNFR1B; TNFR80; TNF-R75; p75TNFR; TNF-R-II
Calculated MW:28kDa/48kDa
Observed MW:

Images of ABflo® 647 Rabbit anti-Human CD120b/TNFRSF1B mAb (A23222)

Flow cytometry:1X10^6 293F cells (negative control, Left) and HEL cells (right) were surface-stained with ABflo® 647 Rabbit anti-Human CD120b/TNFRSF1B mAb(A23222, 5 μl/Test, orange line) or ABflo® 647 Rabbit IgG isotype control (A22070, 5 μl/Test, blue line). Non-fluorescently stained cells were used as blank control (red line).

Flow cytometry:1X10^6 HEL cells were surface-stained with ABflo® 647 Rabbit IgG isotype control (A22070, 5 μl/Test, left) or ABflo® 647 Rabbit anti-Human CD120b/TNFRSF1B mAb(A23222, 5 μl/Test, right).

Flow cytometry:1X10^6 Human PBMC were surface-stained with ABflo® 647 Rabbit anti-Human CD120b/TNFRSF1B mAb(A23222, 5 μl/Test, orange line) or ABflo® 647 Rabbit IgG isotype control (A22070, 5 μl/Test, blue line). Non-fluorescently stained cells were used as blank control (red line).

Flow cytometry:1X10^6 Human PBMC were surface-stained with ABflo® 647 Rabbit IgG isotype control (A22070, 5 μl/Test, left) or ABflo® 647 Rabbit anti-Human CD120b/TNFRSF1B mAb(A23222, 5 μl/Test, right).

Please remember our product information: ABflo® 647 Rabbit anti-Human CD120b/TNFRSF1B mAb (Catalog Number: A23222) Abclonal

No more offers for this product!