ABflo® 488 Rabbit anti-Mouse CD34 mAb (A23107)
$140.00 – $388.00
Abclonal ABflo® 488 Rabbit anti-Mouse CD34 mAb (Catalog Number: A23107) Enables sulfate binding activity. Acts upstream of or within leukocyte migration. Located in cytoplasm; external side of plasma membrane; and extracellular region.
- Product Details
- Description
- Additional information
- More Offers
| Catalog No. | A23107 |
|---|---|
| Product Name | ABflo® 488 Rabbit anti-Mouse CD34 mAb (A23107) |
| Supplier Name | ABclonal, Inc. |
| Brand Name | Abclonal |
| Synonyms | CD34;CD34 molecule;GIG3;MORT1 |
| Gene Name | Cd34 |
| Protein Name | Cd34 |
| Uniprot/Swissprot ID | Q64314 |
| Entrez GeneID | 12490 |
| Clonality | Monoclonal |
| Source/Host | Rabbit |
| Applications | FC |
| Reactivity | Mouse |
| Conjugate | ABflo® 488. Ex:491nm. Em:516nm. |
| Note | Products will be shipped from the warehouse in Massachusetts. Promotion is running from time to time. Welcome to send a request for quote to message@sydlabs.com. |
| Order Offline | Syd Labs, Inc. 4 Avenue E, Hopkinton, MA 01748 USA. Phone: 1-617-401-8149 Fax: 1-617-606-5019 Email: message@sydlabs.com |
Description
A23107: ABflo® 488 Rabbit anti-Mouse CD34 mAb
Enables sulfate binding activity. Acts upstream of or within leukocyte migration. Located in cytoplasm; external side of plasma membrane; and extracellular region. Is expressed in several structures, including alimentary system; cardiovascular system; extraembryonic component; genitourinary system; and skin. Orthologous to human CD34 (CD34 molecule).
Immunogen Information about ABflo® 488 Rabbit anti-Mouse CD34 mAb (A23107)
Immunogen：Recombinant fusion protein containing a sequence corresponding to amino acids 35-287 of mouse CD34(NP_598415.1)
Sequence： TTETSTQGISPSVPTNESVEENITSSIPGSTSHYLIYQDSSKTTPAISETMVNFTVTSGIPSGSGTPHTFSQPQTSPTGILPTTSDSISTSEMTWKSSLPSINVSDYSPNNSSFEMTSPTEPYAYTSSSAPSAIKGEIKCSGIREVRLAQGICLELSEASSCEEFKKEKGEDLIQILCEKEEAEADAGASVCSLLLAQSEVRPECLLMVLANSTELPSKLQLMEKHQSDLRKLGIQSFNKQDIGSHQSYSRKT
Gene ID：12490
Swiss prot：Q64314
Synonyms：CD34; CD34 molecule; GIG3; MORT1
Calculated MW：35kDa/41kDa
Observed MW：
Images of ABflo® 488 Rabbit anti-Mouse CD34 mAb (A23107)
Flow cytometry:1X10^6 Neuro-2a cells (negative control, Left) and NIH/3T3 cells (Right) were surface-stained with ABflo® 488 Rabbit anti-Mouse CD34 mAb(A23107, 5 μl/Test, orange line) or ABflo® 488 Rabbit IgG isotype control (A22069, 5 μl/Test, blue line). Non-fluorescently stained cells was used as blank control (red line).
Flow cytometry:1X10^6 NIH/3T3 cells were surface-stained with ABflo® 488 Rabbit IgG isotype control (A22069, 5 μl/Test, left) or ABflo® 488 Rabbit anti-Mouse CD34 mAb(A23107, 5 μl/Test, right).
Please remember our product information: ABflo® 488 Rabbit anti-Mouse CD34 mAb (Catalog Number: A23107) Abclonal
Additional information
| Ship from Country | USA |
|---|---|
| Size | 100 μg, 25 μg, 50 μg |