ABflo® 488 Rabbit anti-Mouse CD34 mAb (A23107)

ABflo® 488 Rabbit anti-Mouse CD34 mAb (A23107)

ABflo® 488 Rabbit anti-Mouse CD34 mAb (A23107)

$140.00$388.00

In stock

$140.00$388.00

Abclonal ABflo® 488 Rabbit anti-Mouse CD34 mAb (Catalog Number: A23107) Enables sulfate binding activity. Acts upstream of or within leukocyte migration. Located in cytoplasm; external side of plasma membrane; and extracellular region.

Store
SKU: A23107 Categories: ,
Clear
View cart
Order Offline:
Phone: 1-617-401-8149
Fax: 1-617-606-5019
Email: message@sydlabs.com
Catalog No. A23107
Product NameABflo® 488 Rabbit anti-Mouse CD34 mAb (A23107)
Supplier Name ABclonal, Inc.
Brand Name Abclonal
Synonyms CD34;CD34 molecule;GIG3;MORT1
Gene Name Cd34
Protein Name Cd34
Uniprot/Swissprot ID Q64314
Gene ID 12490
Clonality Monoclonal
Source/Host Rabbit
Reactivity Mouse
Conjugate ABflo® 488. Ex:491nm. Em:516nm.
Note Products will be shipped from the warehouse in Massachusetts. Promotion is running from time to time. Welcome to send a request for quote to message@sydlabs.com.
Order Offline Syd Labs, Inc. 4 Avenue E, Hopkinton, MA 01748 USA. Phone: 1-617-401-8149 Fax: 1-617-606-5019 Email: message@sydlabs.com

Description

A23107: ABflo® 488 Rabbit anti-Mouse CD34 mAb

Enables sulfate binding activity. Acts upstream of or within leukocyte migration. Located in cytoplasm; external side of plasma membrane; and extracellular region. Is expressed in several structures, including alimentary system; cardiovascular system; extraembryonic component; genitourinary system; and skin. Orthologous to human CD34 (CD34 molecule).

Immunogen Information about ABflo® 488 Rabbit anti-Mouse CD34 mAb (A23107)

Immunogen:Recombinant fusion protein containing a sequence corresponding to amino acids 35-287 of mouse CD34(NP_598415.1)
Sequence: TTETSTQGISPSVPTNESVEENITSSIPGSTSHYLIYQDSSKTTPAISETMVNFTVTSGIPSGSGTPHTFSQPQTSPTGILPTTSDSISTSEMTWKSSLPSINVSDYSPNNSSFEMTSPTEPYAYTSSSAPSAIKGEIKCSGIREVRLAQGICLELSEASSCEEFKKEKGEDLIQILCEKEEAEADAGASVCSLLLAQSEVRPECLLMVLANSTELPSKLQLMEKHQSDLRKLGIQSFNKQDIGSHQSYSRKT
Gene ID:12490
Swiss prot:Q64314
Synonyms:CD34; CD34 molecule; GIG3; MORT1
Calculated MW:35kDa/41kDa
Observed MW:

Images of ABflo® 488 Rabbit anti-Mouse CD34 mAb (A23107)

Flow cytometry:1X10^6 Neuro-2a cells (negative control, Left) and NIH/3T3 cells (Right) were surface-stained with ABflo® 488 Rabbit anti-Mouse CD34 mAb(A23107, 5 μl/Test, orange line) or ABflo® 488 Rabbit IgG isotype control (A22069, 5 μl/Test, blue line). Non-fluorescently stained cells was used as blank control (red line).

Flow cytometry:1X10^6 NIH/3T3 cells were surface-stained with ABflo® 488 Rabbit IgG isotype control (A22069, 5 μl/Test, left) or ABflo® 488 Rabbit anti-Mouse CD34 mAb(A23107, 5 μl/Test, right).

Please remember our product information: ABflo® 488 Rabbit anti-Mouse CD34 mAb (Catalog Number: A23107) Abclonal

No more offers for this product!